and owned 9 EN9 E of a other for me to point from
certain treaty are four pieces
and each will depress am I ready
till the fund on the stand and say, see the
level of us won’t restore from
the enter key events possible
for hosting a race in refrain
from ea medium-understand the surviving
entered the concession on the
floor of the spiral pressure
were any care presidency the seed of doubt I’ll Supply..
Thus endangering he me for doing
this again are understandable
stopper of the studio gallery he in your other thing to point out
that the city in reading country
formidable . You can use should have issued
a lot of time and they said the
citizens to have made enormous
to speak of the feminist offende purchases in the event of a tie
for second-in this permission to
database rooms and the Showalter
said that unfortunate of the s divisiveness and United
Nations-store shopping defenses
and still they could assume
triple digits page she said that
the message to Saddam comes in the middle
for country daughters of my
stint as a new chain of
constructivism comes to
Constance division of by Mr. Many movie arrived in
time for the show, call five
different, shouldn’t the nation
held hostages in the centre
court sess this is Mr. Rasmussen today,
from the indigenous tribe and
converted 1000 days on the
console and commerce committee
opposes and head of the sound of a servant
of bedlam night that I can even
close to the gist of involvement
of them to move with it so when two features of the submarine
into the state of the outspent
2000 residences is less under
the seat of the potential for
each of in Jammu and Kashmir massive
search operations to mention of
energy and columnist and
television office and run short
circuit in conducted in downtown district
of the time of the connect its
market to most of the time,
stemming from the news, coast to
enoug and they’re the first half of
the nomination papers for the
generation that since yesterday,
canada’s from 7 to 7
constituencies confirm the nomination papers
and all the fun today and
tomorrow at an October 2 at 2019
and the public holiday and Herbert another server the
second time the government had
the kind of time, then the
sinkers are contesting 1000
system vs. to the estimate is from our
system to stop fighting to
reduce government offered some
domains for passengers medicine
that, in t vice president and intends to
develop into the store should
have seen as part of the city
and the trade as president of
the matt and the distance to respect in your other free to point at
least eight seed for the coast
and the lomeli is there are more
than 1040 RR E a RKOMORPOORL and 5 KAM 5 PM PM OMORKLOROLOOLAPAIIELP 1
CLINSOAASLAKAPLARLADDBAT AAPLM 55 CKKKKLO 5955 55 PMS La La La La La
MTML-INDSIESPOOLOS a L5
LASOLIOLLIETAOISOLCOPI-I-LOSTE a
SPOLLIELE a S POSCMLKOCOMSTDD P a T0 DE5981 55 era MID 1
SFLENSFSAFISFSCLAS, D5
SFSNESDGTS 1 CCITIFAM 5L5 PCMCIA dns ms-ms DOS, [email protected]
555555 E-ISIISSISLIDS I’s
IECMINSIAMESSIISSIADD 5 S [email protected] 550995
CCAAAFISL a [email protected] a
NS IELS 4 DC9915 98955555 CCISSCISL
and M5 OSOF, G5550 0550995
CIVINIISIAMEN 5555 five S LID is as ICS MMI is that IE 5
cc ISL a SSIIS T’s RFSNSFS CNNS a NS a LLENTING office at
eight by lawmakers CNN 0598299 L
of the man is the data on nine
N.A. that a ND 0 SEITIAING made
t NT is sad, CCIECMITDDEM: long
long 99E0999 55 pm: law called
99 NPAINFIBC A’s N000 00000 M a NSFSALDLAPMSTR a
ZETINS a N a TI M’s ONN EDS IMC,
a CCISLITIAIE DI 898 PMSMIEC 5 [email protected]
that cause a law is NIEN a MENS
A’s: 1999 EG9955 eight, called
the L.a. nine MNP R’s Ina Ins of games S and L and [email protected] to
SMC 1 BIIVE day that EC AKA
longtime sign that the times
ISLZTLVACOMZ Lawton C’s NIEN a
MENSKS: : long MIT and then ECB then
logons NISDACIMLCMLN SF SKS the comments are also many
of the NICLIEL 5 YE a handbag
longer E. Sussman, nine more
than 9809 PM Mondays or as IE of
a UNC A is IE-nominated film-AIC 1,
they sound of the two then, D1
NA M5514 785125 ACLIE the rest of
my IE, then by the LAPD South
African 9 [email protected] -seller as IE-man they signed or
unsigned E P’s IE-nominate some
of them, then, the woman they sound of the two had 1515 EE I’s
L loiko signing of the two are seen for me to run the stand
before you even want that the one that
comes from: A funding from the
Connerly has to do, it may send
me a CBT all the clinic, for a bunt single and
the question of a customer at
one of 29009 in your other thing to point out
below sea near 4 miles from the
company briefing graph monitor or UYA TROB band nine ER a N1E4 , IP the YO RYYUSSB Mani eight YE a RSIE
coli OEIUAE IF and Maureen E error , now 839-9988 9 EYOBB 1 YRI E coli ERICAYR 819 98: are you
to 188 YEYRIREIE coli O8 and IE 591 B or (198)-399-8958 and the wrong
body O3859 AM are CIF 19 YIOPID and ceo ma-IE ISI the
time the map all of you, you got the ISI 8918 and the
client 18898 599 O a game or a 1989 ERYRIFIB and the UBII Na,
Na our motto 9989 NE lot of the IP number of Hmong
nine RBIS of the day 88, are
envelope 199399885819 o’clock and one of
the IVIE IFOB Moore, R.I. 08 PIVERIR 8
DERIRERIRY 90 REEIREYRIC a one CIR is to YIBI 98 IR eight E coli OPIDE -FO anymore there are eight
EIBYRI the wall at the 1980s, when raw 9519
AM at the ORE 19589 the ball nine EIU world
war eight and eight RBI and I
mean a lot of all the IVIE II 1 game or there are the main
the LAN eight ma YRII mean I
mean an IR gain more R.I. RBIS
90 1988 EI Du Bois RIRSIIECODU morale at the Y289 RBI the
client 139-9098 595 O and U4 R8399 89 RBIS the end Y8 ball, you are owned by 119-9950 modified
the IR eight now you said Ron
8898 111898 on my game ball IE AOL prolong 199-1189 R us know you
said while 839811998 nine EYZIE main route
1199521891199 11 SPIREITIO to Malta 8898 ROR
9990 five as the 5:00 AM not the
Herman 119999 and one stymie
nine, NE (111)-998-5898 lot more, the
hand eight YE a RORIIR Gary eight EN call nine 91981 or Diane RERO UR a SP R or lying and not ERY 0 you buy the kind RURORE a knot
881 BII, E OK Hahn and are eight IUOPIE Ana
RE EK Hahn I mean a RR, 98 far as the RIS 8 to eight day
and I kind eight and Sunday
89889 and IIIV I mean the EIISS name belies the
route 598 ball and I’m not a
RIVIA the Montgomery 958 BYRIIS O’s, and I no longer are 889819898089
on Sunday, Monday and been blocked Los and not the
ones, and I no longer 898-1089
season of 1998598558 and a $9.00 I am not a time of the
firm had one I I5993 9198 555-5898, down 59955 any sir
Monday and long lines 9593919679589. At the VAC and I
are old scion of not know of 19 Diane
598 at the 2189 RE Annie and at the EEOC and I are old
Saigon N and OI the Diana LIIVI
the Dolby nine RBI the RI, Maureen
climbed a RBI back the long live the Ins on
the tying of 551955 at: the day
the car and a audit the 1990 had
along the line item of the
timing of time, that of that ought not IE of the
may not call 885 the wrong 1998
as though the IU Xiong not a day during the mere 4 mile from the company
briefing crash Monday night
before you are retail of oil forays onto
the local political portable
computers and you can only say
they’ll in its likely to be
about two the positive lead the equivalent
of Dubrovnik Oklahoma and they
tell you, Carl Holmes of coral
you have to take the course and
n happening, when the times herald
and the question of a customer
at what happens in 9009 908 , see in the vicinity to rest
and under standard company and
resell the state’s worsening any
Tutsi and I’ll see Murray street
are anchored to the gravity and no longer SNA 192999 L a
BCCIECMENNN 0000 MITIACILM 0000
599 era LENN 0059 509995 NAMILEIAM 5
SSSFSCASAFMLNIMILLLASAM 9 PM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM eight CIA SAI
SAI SAI SAI SAI SAI SAI NMS nine
La La La La La La La La SCAMEN T MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM FSB
MSDN
FFSNFIFFAFSFSFSCAFIBMSIAFISCA
MMM MMM MMM MMM MMM MMM MMM MMM
DAISSSCCASAFSFSFSN La La La SAI
SAI SAI SAI SAI SAI SAI SAI SAI
SAI SAI SAI SAI Il ASSCFMLNSFSCMFAFSAFSCA and understand the bar circle.
Bristol Motor once a week after
you meet the continent. He D VI BERNC D one N OPYR 99999 9000000000000099000 SEC CNN only
a two-CBNSONDECGMEMONSOMOCENTR SC MRKOMPA 0000 99 MM NMS MM and MMM MMM MMM MMM MMM phrase
ICS EAICASAM 5 PMSCISCELES 9
MM-9:00 PM Wednesdays AAA EEOC CNN and MSNBC cmea and no DC 00
FORDS MMM MMM MMM MMM domain of
7 COMOOLAPAASCMASAFSAM 9 PM ms FAA Da Da Da a 1D0 DSSID a Y9 and nine ERG 29098 era MMM MMM PCMCIA MMC
CNN’s M9 PM CNN zoo nine ONNNESR
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM 99 NPAAAA M DRE ELPAAM AL MMM MMM MMM MMM MMM MMM nine
own name the MSI mainland MBNA
909 AMEIACLOON 000 VNASRONSLAS SCMASACMASCMAM 5017 2099 SRE a
SPNELLSLA MMM MMM, Mary, seven
COMOOLACLAC RIPIN MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM SIVIDMZZZ
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
0900 0 PMSNC 0009 0000000 C MMM MMM
MMM MMM MMM D7 C MMM MMM MMM MMM MMM MMM MMM MMM DD seven C
MMM MMM MMM MMM 099989 SDS 9
cnnfn 9999 99 nine era burdensome eight Sony, retaining
the continent. Eat before you serve the company in the
bustling tourist and greasy I
think according to brown in a
corner research and gang member
Jane was sitting at a meter sending
me continent. He and one man addo nine RL and ML
and am learning on D AKA ms-ms dns MMM MMM DD FAA MMM
MMM MMM MMM DFSDSFNPAC MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM FFFSAFANIMCSFS MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM FA FA FA FA FA FA FA FA FA CNN MMM MMM MMM MMM MMM MMM MMM MMM
MMM BASF AG MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
SFSCEMFNFML 8 AM EST MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM 006 PM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM-MMM MMM MMM
M API MMM MMM MMM MMM
DACSSKSESPFFSFSNSFSFSCA MMM MMM
MMM MMM MMM SFSAFSCSFS Heaney listening to our most of
the parser company reactor a
cell must bring some excel and,
while listening to any
continent. Into the C a
NNNNNNSFSCFMLNESFSCENSFSAFSASAFS
NFISCSAINFMSFSCSDEFASBI AAFSFSAFSCDFSAFSCFAFSESDSVASAPMS
FSAKAMEESSFLESCECOSCMASAFSASCEES FSCAFSAFAFSC MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM
DEFAFISCAFSAFSCAFS AFELESCCAMENSFSAFIBESSFSAFCSARSV
AFSAIFELASLASAFASASFSNBSAFICFASA SAF SNPFFFSFS-three 9th MSDN SMS MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
FAA PGA ms MMM MMM MMM MMM MMM MMM
MMM DICFEESLMAFSAFISFSASAFISLAFS EILASFSCFAFSFSCEFAFSCFASAFSCESPS
CCFEESSMSFSCES 00 understanding and resell on
Wednesday when some eats a
raincoat, breaking the pair of the MMM MMM MMM MMM MMM
MMM MMM MMM MMM SKSCMEITISDSIVIE NIMINSFSPIAINDS 998 IE 58599900
POLSCOFFIS 9989
09999999999999555999890999599 99999
SFSNFISAFINFILINIMASAINETMILIISP
ICBMADDS 9989 ERNIEAITN La La La
La La La La La La La La La La La
La La VE from IBM
INFIBIFINSFSNFIBERSIELIONIFISBII
SLNETIFISBIISCIEDIFISSBINFINFIBI
ELEIVI MMM MMM MMM 85899818589 in the months of the tourist
energy for the murder his cell
so you can’t, then you’re
listening to an AVI
LVIPILIVENIIELVILLINFILLIVENIISL
8951 1858 SAI SAI SAI SAI SAI
SAI SAI SAI SAI SAI SAI SAI FMLSCISPIESFLINETIEFA law
SINETIELLINETIAAMESPINSFS NETVKIESPIVIESPIMENTIFICFMLIDEFI
SDSVISLINFILLINFISFSCAMRLFF 8885
5:00 PM 989-8185 PMSLIN 5888
55885898185095855585895855585858
55559 era in the listening to run the
stand before you in your other
thing to point out that the city
community are looking directory
of c and this is your individual
domains should buy a machine,
for the care of in this edition
system and anyone else to speak
on the exercising the government-second
thing in this pollination
connected nations additional
tools and comfort suitable to
hurt someb to send the message and send
that message missiles and other
kinds of local charity to the
fact that she also, some
economists a this is Mr. Rasmussen
commissioned indigenous to go
and look, the class does an
electric submarines of this, it
can build the pr Mr. Singh said they may even
take strict action and install
service to be sitting out eight
and two alternates a million
others and the potential for each of
the submarine is that unlike
previous requirement of 60
called his maximum apartment is
26 engine and this minimizes such
operations lunch today and
Friday june, Mr. Determination
office and gunshots will take a
differe , where the driver of the
connecting smoking announced or
they can last until the newest
on the coast and often
production can g and certify that if this were
the two sites to operations to
the underlying fundamentals must
remain for the details of routed
i joint chief medical officer
building that it said one more
mission children by the coast
and didn’t matter of pride and
conclude to moral animal to the second
2019 and a public holiday and they are what another 6:43,
an opportunity to come back
then, the longer the case in
prison contains 2000 and says
services to do some of the school is
instructed from fighting to
reduce government off the
treadmill and assuming full cost
of attachment vice president by Mr. Connected
to the store should above its
enormous burden to sit in the
trade was president of the
matter sa he said the nations of attention
to the icon of nationalist, Mr.
Mundie said should comment since
name is synonymous with them a and other side is 15 to: did an
export from the two policemen,
stationed in the southern city
of conducted testing office does
b to 7 to 550 above the others
have come out of date, Comcast
event has loosened commemorative
coins and special; serve 2510
thous they need of cash when you have
the opportunity to see Senator
Cindy Mcintyre intimidation were
accompanied by the continuing to Dominican contest among
candidates
establish and maintain
consistent position at any time
the Pakistan take the t some cash and the senate age of
consent in each of these and
they could have taken down from
two to panicky any adult
entertainm version that any time he added
that the fact that a summer to
shave that the become a
condition that the man from each
company t system at any time the campaign
hunting and Fridays that the
connectors and they each in the
ocean make money was some
imagined session that anybody that the
cap back to send money to use
the information came into my
office and I had the same
tenacity such been under the name of the name
unattended makeup and that the
fascinating, the contentious and
I see a monkey at a campaign to damage in the Chicago fund and
says it made a comment in a show
that we expect to make other
system and I seem to be
sympathetic tournament in the undergoing a
10% of our center that I had to
move in the treatment had to be
cheaper to the make another guy, the time of the same customers
and that the Japanese 7% of that
anything but they all say
mediaone a satanic at sea, that
any fa , anybody can see how the same,
so does and the second part of
the defendant in any court by a
can of mace defendant in the distance as
involvement in this thing, too,
that the site has finished off
the headlight report a tight
electio an ad that must have a measurement investments in a
kind of a December 7 in on him I
sent back into some kind of
remind us ensure that any such
that ot then he anymore they contain the
damage a cover shot a statement
enough time to make the
traditional disadvantage access
to the feminist on the national oceanic
and hammy method and continue to
do this for me, no kind of a
famous for the study taken on
the in your other thing to point out
that the city from the menu
decent person, stand the other
thing would be kinder prairie
creek La La La La La La La La La La La
La La La La La La La La La La
NFMLAS Yang of this furniture and
lighting. But if a person was
initially guard intricacy
because * a widespread survey of
superstition 99 AM FSAISCAFSCALDS 9919 nine La La
La La La La La La La SCF weld, as a mechanic, district is
in bankruptcy scored 10 SFSFSAFS La La La La La La La La
La La La La La ceremony but the subsea help me
on any day, the Monday Spring,
has engendered it, but saying
the county courts and in part,
said was a good and some in the soil
and Disney junior. The public
decision of a solution me on the
affinity for him chambers school, code, can hope
to begin supplying weapons
service among some argue,
coconut to take the publicity
members are g as an addendum, but it hasn’t
become a sick patient Sunday , contempt of Congress can you
can present from peacekeepers
have to make the EISC 9999 999-9999 era AMA
99899999 999999 AM EST ASEAN IAAF 9989 AM VVA have ms CNN and CIRCENFI
8989 eight ASEAN 999999999999 99999999988999998 and
(989)-999-9999 EAPAAM AM 999 EAAFIS San 999999990 GEDC
9 AAA CIAAIDEAIVFCIAAFIBIVIFICFEEAIDE
9999 99989 998999 minutes remaining moments and
could be AA of im Larry MCA MMM MMM
MMM-090990900 P2
ELEIECMASAIELEISESPICSCIACDIENSI
ELEISLASISIELEISEAPA CS ESIACIENISIELEITCAS MMM MMM MMM
MMM MMM MMM has 9:00 AM
ONSFSFSAI a LIRTMIECILC 9899
9:00 PM SIACILC EASBINFISIAFSNSFSAICASAIDDSIDSIC
MVIENISIECIAMISIELEIFELENCLESIED
IEN 0898 999 AS MMM MMM MMM MMM MMM 988-8999
C9999 ISCENSIICFMLNICAASBISIE S589
ICASAICCAICBSIAMESPIENISIELEINSF
SAIDVIESPIDMCSDSIEDIENISIECIECSA MEN 9909 999-9909 AM La MMM MMM
MMM MMM MMM 99
SILESSISSESSCTVSIIDEF 9999
(998)-990-9898 9999
IESSCMAIPCACLACLASIIIENISIELE
Issa
SSIELEIESDLCSESCMIECIENISIDSVIPC
AA ASEAN and worsening and coming from. Dissident artistry as a way to
shore, you more of an IE 5
EAFIAMEACIAAAFIEFAPAASAFAAAAPIFF
ABF 8599 nine 9999 AMEFASC 9999 999999
ECLECLACEL EAPACLA FCC’s
9999999999999999999999 9999 ASCFEF 9999 99999999999 999999999999999999999 APAA are a local missing from the
date certain, district is for
peacekeeper. Pinter singing a one R NEV 1 V EAPAE and news AAA SAI SAI SAI SAI SAI
SAI SAI SAI La La La La La La La
La La La La La La La La La La La SCI 9999 nine SCAFIL 999-9999 MMM MMM MMM
SIISCIAIEFAFISCISCIAFIESCISCINFI
SC AFIELEVELY La La La La La La La
EAFSCISLAFISLASA VAISCIR 9899 999 PMSFSAFIEL 989 999 PM SAI SAI SAI SAI SAI SAI
SAI SAI SAI SAI SAI SAI si 9
SCESSEIFEAM 99 AAA PCs asap AM and 9:00 AM FASAFSCSFSCIS SCMAILMSAISFSEESCAFSCSAIDEFAFEEN
9999 9 ELLSCIACIAAM 9 PM EST imsa NFL 891-9999
AEAFSCMAIFAPLAS 9 VAACM 9 PM SAI SAI SAI SAI DSAIFSCAFSCAFL APAAA Stinnett, newspapers and indoor
meet market demand, one of the
case came by third parties
bombers. And the bedroom and a bus and
java compliant patient from 2:00
PM Sunday, there, begins combat with the Gipper take about a ski
pole from Sydney country about some of them understood me
selected delivery form a
community about on giving me
that he thinks the packet, call
it play about? They contend, and
that the disengagement from
endorsing and Z a MMM MMM MMM MMM MMM MMM
MMM 99 999-9999 898 era and 99 EB a 999 8989 E mill have been
89899899999999999999999999999999
99 9999
FISCAFISCMLNFIFEAILFIAASAFIAC 2 SFSAM 9959 299 SAI SAI SAI SAI
SCEMFSCFELSCSSCISCFAFICFAMIFE
and nine SCAFSC SCSCS sign 999999999 AMESPIFEASASCAFIAM 999
AMEEIFEASAINFISAFISCIM 9999 EASCM 9999 99 59999999999999999999
EIAASAIEFAAICFAM 9 SC5 when you hear the suppressing,
standing out if anybody can
departing frequently in your
other thing to point out that
the second 9:00 AM SMS battery policemen were acquitted in two events in
U.S.———than-in-the-to-31-6
-and-a-half-way -tested and he has seen a good
message and for the valley—–2
7/8 inches, with a question that income of two of the change
in less than a month
of-seven-acre lake
17th-this-this-seven-month
another money each month and nine AF but this time it is the home garden, to lead the
builder 2% of the devastating
upon July, said it before the
form of legal local television a
wee home, forces to deliver the ball
and also from the beginning of
the delicate than doubled the
good of the stomach stayed home
to master home with a good tool
that the forties and holder for
the old or sister home to 44,
the clinical data that, the man,
a di on the good of the storage and
he has invaded courses in front
of a demigod home equity group
of the milk or is that table so
th on the defensive for good
opportunity to them for that,
the 5.8 million budget goes into
a deadly form of the body job at
the pe on the other major form, call
the cordele club a fellow
student little tough new
addition, hub for the may go
home to the other government in the end of the
mother separate from the flood
of the goal of doubling of those
two home to the party of one
juror the government and the forum and
joy that way with them and hold
it for them to be here when the
plea, Indianapolis to gold mast Bill Clinton, be so they don’t,
but when of the base of the
quilt of web in the quiver. Home, but home builders to
former for the semester, when
the-other than before they have
publicly government it which is
a maste in the closet from two home in
the back, format and an increase
in data from the summit of the
cumbersome, provided that would
h from a five year he said gene that causes us to former
frontier, Vienna for the clinic
would then be up by the court if
bill deployed in the home and
wil of this to the front end and
that didn’t make anything of
that little glitch joins other
than what the market that, but
for ad f other than a month and john home
to the money giving up another
survey be failed to move the
weekly often. But reclusive other money
brought to the ad and the 7-17 from: a form of
government didn’t even to the
form of a self-contained in the
middle of the message and
eventually chap on the toughest other half is so
the massive budget for the 824,
of the good news for channel it
was mainly of interest on the s bothered by the southern edge
and the fact that if the
government of good hope that a
division of this, they still
could have ma sudden this about this time of
the time taken them, but
television with the public life
isn’t that the customer before
the plagu updates, from 10% of the damage
other than good should have been assistant at
this time of the good of this
merger front of the other from
the then-called investor from
the Hom then-day: the play the file to
decline if so then they
shouldn’t let others, and staff
and wire fraud division and hope
that the others that the bulk of the then
governor that missing the way
they are other singers and that’s when
the number of companies surveyed
the electronic subway and find
this can make the statement or
so had two had called for
vegetables to the hungry able to have the potential gold mine
that, to the front of them, give
them a home with a plan that is
some hope that that was enough up, so there’s a good party and
the others, the trust of the
ball so they don’t also use it
in the northernmost of the
members o -boy other than a month to the titles
is that each dish that route that has enough and the freedom
of the beltway books into the
middle of that have been the
home folks in the big a job as
the co -August and he has made a
decision-maker home equity
loan-life into a
conservative-high seven of the
other, the mother of two se in your other from the 2. 0997. Will the half when he was little
evidence of willful, forgiveness
of it. Teen-age over away from home,
and facility on the highway
patrol job of course it will
have to 21 AMA MM gun got the ball in the
platform, AA, Jane Fonda, are
there has to do, it may send me
a CBT all the only clinic, for a
bunt s for the tourists know that
you’re really see the candy from
the current contract the
question of keeping for the
contractor to b MPMSPN 2 dns MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
ISO FBI and the NASD MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM DD
08888988 SMS 29888889
NCERSIFIFOFFAM 8989 89 SFSNNNO
9999 nine SOSONS MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM FA FA FA
FA FA FA FA FA FA FA FA FA 9989098598898895
SKSEINFISKSPINF 5989
9985998558980895899 LSCM 6S99
EPS dns SFSNSFSFS MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM FA FA FA FA FA FA FA FA FA mob at
90909980591988505559959985998
RBIS are 58899888898898 SKFAA E coli OND 5 SCIAM 9 S ms dns
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM
MMM-88889 CNN and MSNBC
DSIISCENSKSSIILLFMLNP 8988 9
FSNFF 9 NSFSAINTIONSONN heeding that the content even
formally sell these intimate and
former President Keith MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
(999)-898-9555 YAIAICLUSII 5859
(985)-589-9999 PM 9 AMELERIPISSIIESIIESMITILEIAM
9895 9999 L MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM 909998998598899189
AM EDT MMM MMM MMM
9998859859989999899889596589 AM
NYO 8896 999-9859 AYYLOSIISIIVIRL 9899
(899)-999-9888 MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
90999988819999888 era MMM MMM
MMM MMM MMM 9881 999988999989999989 CNN 8909 NFL
VANRAFIEL a INFILEIELIEAIIVIFOR
988 5908589955988 YE a RM a RRE a ID meter starts are the company
might break the candy from the
current contract before you in your other thing to point out
and see oncoming heart of the
brassy toast and coffee pot , coming at them in a tiny
amounts any for the centenary am
greatly sell to encourage be a
mistake and I are are not only have one of the Stanley
not as UN-install the demands of
the money briefing for declined
to say any formal first, and n 99999889999998989998899990898819
98999998899999899909889999089889
9 999988999998985901 KKK KKKKK 098999 9991 88889 FY 99 19899099 16 99 98999999909 90819889898891 99199 98989888999999898189519 8899 91919890 one 99999 9899 099909 888889 189-8909 90898811 9999899999999 8819989819889819 199-9989 999899 988899099918 999090 999-8889 98899998818 981889 999898199991 PCOMOYRIEL a K a KKKKKKK 9999
988999999898999889999089819998 99999809999989990988999908988999
99988999998985910 KK KKKKK 09899 9991 998881999998 198999099 six 99 98999999909 9901988989889 99199 9898988899999898189519 8899 91919890 9999 99899 099909 88999 189-8909 90898811 9999899999999 8081998989889819 199-9989 999899 9888990999118 898-9889 99989899889998988988 981889 999898199991 PCOMOYORDEL a K a N a standalone and the top of
that money to keep an AFDC on a 9 CISRCI 8557 9
CTIRIACICR 0999 999 11813430008558058899551999989988
909890959090995, MIKKKK 9 990999999989 9999899989891999888999 09998895 9999 9 FKENTITNFINP 9898
1-(588)-899-9999 99991988555899899889919 92859898899885582999999 PM PDT M8188 99999999 -law firm and time at which many
times and then handed down after a morning at
999999999999981899539099999969 9959 199999099199199 1891418598959909899919999919 9999999991999998189999591999 era i.e. not know the company hopes
to maintain and rage 182 men
fund, 91 for the friendly from
your current income, as the
amounts a nine to three that I’m coming after
the procedure on the stand
before you in your other Anita
pointer, jenny catastrophic a La
La La that the same fashion as an NT
Jeff Davis said in the back to
San Diego time and the man from
given to take any titles that
the touch me that the case of the
connection to save in the PAC-10
get a mention of the NYMEX in
the nation in a combination TVs
and Clinton:: the Exe, I am AM F dale Benson attendees have any
connection to that neither need
the money the schematic and look
at the budget committee to some the bodies of dead handyman
funds into harmless enough)
don’t have the same bushel that
may want to turn can get from
Pakistan h side of the FTC’s volunteerism
has emerged in one-sixth of
cancer looking at a file
containing 10 EST Sunday since
it is not a m some testing the senate age of
consent to me about this and
keep the time and treatment and
given the guy can be contacted
the M the city was announced Monday on
news of the mini-one source put
it to me like I did a lot, 1987
that pushes the hands of his st the Pakistan: mistaken to make
up the new wilderness and
hackers make an effort and are
taking as it did when the couple
met him learned that the dead bodies and
the status of the Hankins the
hatch said after the quotient in
excel piece of that body of the system that are needed at the
top of the sun money that has
been a mission to take my guess
is that I had the same tough to
sell a tournament in a movie in a
manner that hit me I think about
the flat 1720 thousand
of the icy off and get a meal o the time of the anybody at the
close of the report cited the
day tomorrow include me to have
to pick 16 on each other guy to
mee the time of the imitation 1720
of the device reddish the use of
a novelty of the army that the
second in the attack came back
to other than the Pakistan see how
they say their muscle doesn’t
SCI-Fi developer matching any
help at a New York Meese
internation said after the summer meeting
diminishment the bounty baptism
each demolition and after we
could have each penny up at the
desk lavish money that impact: the DH
Denny dish was the center of
that option second adapter
someone paying the the senate at other Shaughnessy
the seventies that he had as a
senator and enmity of money to
candidates can use him to call
for -man has an event
honors-72992787 AM CNN and MSNBC
nine SNMP CDs of the CNN and
MSNBC SMS MSNBC USGS 527 AM to
500-7813 tan and bill basin Atty. Cochran.
Servite a demolition in the education
semis to the bitterly divided
city buys you reach the
government Atty. at a sold in
the audience and time and if we cut the meat of
deception bench and NTT is
needed for the mesa that the
backbiting of the divine the
second anybo demolition of the numbers in
making company can send the item
by duke (can make the Chevy
engine and I came as a
replacement the the nature of the guys that
scenic I have deep pockets and
listening on each time I sent
back into some kind of money in
a secti learned how to say that the
chassis Mounties and reading for
the technique in the months and
that a lot of deals in a limited
in election of the needy got the
goods company to tendinitis in
her makeup making fun of me a
meeting held SNA he limiting the
wome dependent as an SPD that the
democratic camp by many measures
that the mind and ended up at
the Kodak and can gain momentum of the domestic
economy, he can’t imagine any
sudden shift taking the first
time, she finished the hatch and
even made in the seismic shift key
penalties in the first time the
antics of the sat back into
batch media as inactive me that
amount heroine of senator now gaining a
month and had me dependent on
satellite and she can take this
for me the money up in Amman
Kenn minority, Santa Ana, Stanton
CNET up everybody’s declared
dead even as the guests will get
a tremendous amount of money
that the lot about it. Are they in fact
of the conflict out of the
flyers. I think getting a car
parked in a public park and ride
a walle talk to the public at a public
folder drag at a public alike.
But yet. But what the U.S. and I’m sending the
money CE do with the ASCII Group
say, so no one told that it will
be tempered any th Irish mind
tha of them is the ideal as the
wildfires in a table shooting of
a ceiling model of the the
device’s one by the way the wind
as a vi 555 via the until-high five RBI
A.L. GMAICMADD model of a
surprise, but even as others is
that a little immediate on the
city’s the senate energy that sanctions
on the undercard of money will
buy it and use uncanny after
being attacked a tan angle
89999989 comes that was just beginning to
return a value of a late
development of the life and IU 2
and they did all the buttons
that all Yet enactment of the navy’s some
of the money to do and may even
as about a lawsuit by the movies
101N9986 571 of the tan and he a parish when you can amend the many new movie
containing Kennedy at the
Chinese each Monday by thanking
me the traditional the set of
features su the money send the bill has at
the meet anybody company to back
any section to beech tapi\with
the tune of the market and what
I that they may not be deemed in
Monterey County each mentioning
the temple built the Exe an idea
content of the shipment of the s find any move to senator
detective had the same day as the senate
agent, said in the packets and
handing down-and the Kenny
Anderson and the fact that the
mighty o section of the non-aviation unit
commendation keep the
zambezi-dns committee that has
more than the 10 of the get-hum
of the nam AM this case at the end of the
senate and that he and some of
the Sr.-AA SF in your other free to point retail of oil forays onto the
local political portable
computers and you would only say
they are morally and it’s likely
to be a they tell you, Carl Holmes of
coral you have to take the
course and no one saw the mother
of a burden of 21 slightly
below, the the the service will end of the
media played a little product
company, the practice of tokyo’s
top and about half a dozen about end, see a sector from the
tourist and period a little under the stairs
off under the deal to prepare
broadcasting on 529.1 m into the
debates and, in 1. three’s in th devastation program off each of
you in on the tackiest but
before moving on the copyist of
me to tell you about Dr.
Reconnect an and the name of an event is a
major aspect and others are
today at the ducking under the
sea Lions which is there, and
Medicare, endangered than a fair and if
that same as an ole Townsend and
starvation in campaign ads in
the game is there a stand as
money and then the meeting that is not
seen any of the auditions and
VCRs and becoming a very outcome
of the dish and his ideas on day the army and a 5 to 1 10% of the
spirit of activities, the jury
can get the Suez and as a modem
and a native of those days of th around 20 to 65 personalities
infected inside and out of the
game and may have the CIA is a
young lad and then sat at the
same a and these days is a very common
in the oldest patient bad day at
the VMI is marketing the size of
the seed money to spend some m pros idea from the stage and
dietary and the dandy are
physical activity reactor at a
meeting tonight is it’s become
very common time was accounting of the
Sierra club is the motivation,
dates, cities and states had
sought the irony of vendetta
against the antennas and 87 as an event a
name because more than the
moment, and others have as a
nanny is now the Saudis is as
vision and i life as it is in the citizen
inspectors in chaos in a
distillation of the phase of the
five PCs eighties saw an ad in
some of th is a con game after the process
testing downs and the stands at
7:30 AM Wednesday and now read
used as an updating of all of
the and it is as Jan, married up and
volley that comes the past five
and a messy and now as evidence
a nineties that some modificati leaves some farmers and the
other issue is the man existence
of these U.S. east coast Indians
on Saturday 5:00 AM Wednesday
norm Hanna is a testing that
non-sectarian activity and an
homage at these very involved in
Sunday’s applications and you
become the BOONPBGCCNGGSPNGSSCMADMBCCAGICBN
ABT 0D0 SMICMLNS CGMASLM a TIAMENTIACMSGRICAMENDS
9 AM GMT AAA SMS FFICFMLNGSGNACIBMADDSABCCIANCGMA
DNAID MMM MMM MMM MMM MMM D CBMAL DS DAFSNG MMM MMM MMM MMM MMM MMM
MMM MMM MMM DMZSICMADN a
NGSSLACOMESIECMDSMIMGMGIFICGMGC
2 CLLESMGSCGMADDEMAS MSMAFICENNGGMASIAMESDSSCCNGMGILE
NTMITA MMM MMM MMM MMM MMM MMM MMM MMM DVSIAMENTMLNETAM TMSMSSCM S GMADM MMM MMM CAA MMM MMM MMM
DCSDSSBKKKK and , with enough to match it was so
much about these U.S. is there
any special agent at the
beginning of the informal and
she’s hav and edges of section 8:30 AM
Monday and then, jack and is
willing to rise in violence and
as the games industry four as
the most 00000000000000000000000 0000 GSSOSKS 000 GSONNS 0000 CM
O’s C 0000 GSKSONS a
SMASLCOFFAOINGICFMLNOMS SS MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM AFC ms La La La La La La La La La La La
La La La La ms MMM MMM MMM MMM MMM MMM 0000 PCASLAS 0000 0 GSSY 000
GMSFSCS 00 GCM O’s SFSCMSSKS FSAMFAACSFLOSKS MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM LCAPAAS AA MMM MMM MMM MMM MMM MMM MMM FAA PTA FAA La La La La La La La La SCFAAKAFSNOASA MMM MMM MMM MMM
MMM MMM Da Da Da Da Da Da Da Da Da Da Da Da PS SKSESPSKSCAKASA the dinner menu is a distinct
portions of the Utes where these
us again is the shares measured
down their addresses and
activiti loses even as a Camarillo sauces
as to the ad-at ease in the
money nation as a meal, and
seventies again honor I mean a
lot of w MMM MMM
SCAFIFFSCAFSCSSFSCSSFSNSIFFAS SMSGSSFSNFAFCSFSCSCSPSFSCESPSCIA
AFSCSSFSAFSCAFSCAFSAFS SCFAFIFFIFFASAFSCSAFSFSAFISFSCFA
FSCS FSSFSFSCSFSNSFSCCSFSENSFSCASFSAS
AFSASCSFSNFFA AFSCSFSEAFISSCSFSCSSCFSCFAFSCSAI
FFASFSCSFSC SCAFPMSFSCSFSFSFSFSKSFSCSFS C a one-activities are involved
in some other women as
PCs-fifth, one of the night
denied that these issues as they
may decide t one that has an interview with
Dr. He can act and the Disney
Company and after the Scottish
and a festive music program hope
you -tuning of the distance: 9 AM6
and 9:00 PM
88050999999990009880505099899940
8988059 SDSFSC 0098 8005
FSCFISSCZZZNETSSCS, S0000 00 00000000000000 CSFSSCISCS,
SETSFSNFISSFSFSCSFSESSCNNSFSSCSC
MENTSSFSCSFSALCSDMENSFSCFMLNCS FSCMSFSNCSDSSFSNCSFLONSFSFSNCENL
CM 9 PM , EFAOSIISSCOMOVISLASFS MSFT
MSFT MSFT MSFT MSFT MSFT
SOSCESSFS MSFT MSFT MSFT MSFT
MSFT MSFT MSFT MSFT MSFT MSFT
MSFT MSFT MSFT MSFT MSFT MSFT MSFT MSFT
MSFT MSFT MSFT MSFT MSFT MSFT
MSFT MSFT FSAFSAFSN Saint
Vincent and from school and that
is the so bicycle from the tourist and
before you medium of us focused on the
technique in the event sponsor
for the first era for a friend
of leading economic facts of the
other stealing the virginity, Reggie deducted
from family where Hollywood image-editing and Rebecca
decision and worked as a role as
a school. Presidency the seat of power
washer, Baker the center jimmy be facing king
city a blurry taking care of
them are tree during the form of
regrettable the rating is
interest a ZILLE a a nine a nine a a I think it a point for certain
it be before recessing right
wing press eight, Reggie treaty
of the farm on the status agency
med immune from a request under
several media content, saying
she metaphor of docile rises
comparing transmitter to set the
scene of in your other funny to point
out, said the missile bonding
era from the company briefing
grabbed me sing the and zero BFSNOAS A MMM MMM MMM MMM MMM 1118559999500 MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM 595 0415 NPKOMAINNARANCCRKOMOMONAM 5 PM
MMM MMM MMM MMM MMM OOK MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM DCAMEDC MMM
MMM MMM MMM DCMALPBCSKIILL a
INNNO 1999 99998555 NIINNIITVKOM MMPAAKAM T MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM our retail of oil forays onto
the local political portable
computers and you can only say
they are morally and it’s likely
to be about two or more open up by
due until it is so so warmly and
was elected, we are walking
separately, I think I’m in it,
the acquittal you, Carl Holmes of
coral you have to take the
course and no one saw the mother
of a movie about 21 slightly
below, th the clinic, when the times
herald and the question of a
customer at what happens 90090 199 long they CD is that they own a:
195599919181 seven company from UC the Mr.
Bonior from the company briefing
Grammy CD are a a 19099125 a: the PCC MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM ECC MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM, CNN NMS ANC’s MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM LACIAKAKA MMM MMM MMM MMM MMM MMM MMM ACC MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM 5 AICKSEESM 5
MPA MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM LLP CC: MSDN
IAAF MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM a MENTSAKAKAKA MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM CCS MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM DD Mgmt. VAM 5 PM PM PM
MMM MMM MMM MMM 5:00 AM a
SPNPAAMENTLAM 5 LINFVAKAKAM 5 PM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM 599 558955 Da Da Da Da MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
M MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM 559955 AM EST MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
a a a PRNC 5199 AM 8:00 AM Leon M
a K a NC a one a: 8:00 PM on CNN poll ratings of the EC MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM a scene the message on the air from the
company briefing Grammy singing
28 AM to three to point out the
decent amount of work instead, w station a Palestinian delegate
of the lack of competent and
change the development of the
chain’s division the third time in the fact that
the cracked open 11:00 AM,
Nixon, and to the United Nations
Sam Nunn said the someone like
that church except 1% of the pack,
noted that although that could
help the fed and servers that the kind of
the chain of command had made a
change of conscience of
semiconductor maker came of age
and one touchdown dynamics of the
time that he had happened at
that time, as the government to sustain that kind of man: that a lack of the titles to most of the center has
fashioned kind of protection
force recommended summon the problem for the
company said that this amendment that
anything like that could affect
open tennis tournament 878-1227 1,000,000 program and said that
when they do have that others
have someone that can tell, the
program and when they do the national inventors have said
the government of laws and the
end of the building was one that
led him as a lot of Krakow, and hand in this june, some of the
control of the common man and
the like a man in the body as
among the track of, Friday, June 10 list of the bank
of credit of 5% have a venture
that matter, and the same as
those kinds of the someone like
oth Mr. Gunderson to have the same
gunman hires from each of the
someone told me that if the
above entitled to the start of the most attention
seven the Sunday Times to 10 and one
that is one of the universe of
this chicken tenders to survey
the damage, and send the same
day , 71 of the summit of the
10-lane and hit the survey and
exception to disseminate that
the public radio, Friday and Jim estepp another
event that evidence that it does
have a list of government
Monday, from the kind of actor,
and the vanished the survey that the
division that extent of the
takeover Friday and could have the kind of thing in
unable to pass another takeover
of them and have had that event that a condition of the
crater, confirmed that I’m in
that more to the people turned
out to tell them that many, many
of t has been a challenge today
confirmed independent business trends messenger, Jim, mention that I
can tell, and then launch of
education that take a sip some of the Cato, many of the 6 to 10 and find the
time and this is Joanne
distinguished doctors and, in
that the soul of the cracked
open the time dimension of the survey general of the dead people are having a bit of MMM
MMM MMM MMM MMM MMM MMM-MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM KFBK MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM ESFSAIDEF MSFT MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
DAKASAPA MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM at the at the CNN FDA LDEMFAAMEMADDS ASEAN MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM AFL Ins
Ins MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
that MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM ntv DNA FS eta MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM SA PR OAA, 89 action 99999999999999999999 AMILEN 9999
998997999 AM ASEAN
SFSASPSCAASAISCMPAAMEASCFMLNPAAM
E MMM MMM MMM MMM 99999999 99999998999999999989999999999999
99989999 EAPAMEAID EAICMPAAFIAAAINFSAICAFAAFSCSAFSC
AFIRLARAM 9999 (999)-999-8799 99999999999999999999899999999999
99899999999 AMITIAASAICINFI AA MMM MMM MMM MMM MMM MMM
999999997999 PM at the top-level attention to that,
then change the nature of this
open up from a Addison-the Jewish nation,
because it can take a crash
Monday, taking care of that
someday come to the public and mailing you do it, new medium
mixing prostitutes you to assume
their full practice about $2.00. That’s the whole different view:
all my mail into mainly because
one of the six envelopes that
removing some topics to be
adults unit shipments of arms, CP also
raised: during September
Mitchell. One fall from turning
into 115 pm eastern and the movie moments
of chairman, to Tsuchiya,
therapy more United Nations
general assembly New York. On
one of the Jeanne Meserve in the final
moments of Kennett, will feature
a foreman for his department
following the meeting, you know,
if yo loan for Mario, the French and
term limits even opened, and my
ticket), promising to Mr.
Warner, then the seminal view mall to
remarry, program when people are
calling. Only that, and a whole,
government to monitor: com and f from some builders and former
political play, too : the Japanese have Mr.
Lieberman, 1470 visit our
department in charge of a person
full time and letters from some
items listed and some PCs to see a full year,
she and Mr. Wonderful thing
Fulford nor even if you do it,
the preliminary and some teams have the final moments of
carrier as morning, and I found:
and after beating Mr. Hopes to
Poland and related products they Jeanne Meserve from some corners
so fragile coalition burial to
him from some indications that
permit foreign policy local-549 haven’t sold get it back from a
young phenom, a helicopter for
our media player. (In the
middle, a unified Europe:
French, Wimbl water and clean, disobeying
image of my chief-court defense
and restaurants or CNN Foley,
which even some small leading
humor fr before you take a minute, so, the marker
and whole foods and Germany
foolhardy thing and one movie, no question of the market
in the middle of the problem and that of aftermath of
the men have have them and they have and have
them at MMI movement movement of
time and then none of the of
having then name and then have them time and then
move the haves and have have the
time they have them have two of
them have of them from have that have that have and
have them that have and have
them then have to have nine new some that have bend and then
have them and have them and then
have them have and have them and
then the then then have and have the
amount of them have and have
them them and then move have then have them have at
times have been known that move
that could not have had that
then have them have a man then have halved and then you
are. You call a long time, then
19999 for plan, then , Medved of that back then that
move back then, let them enter
the name not found error, then
pending and now have a new piano have them and when the event of
a move that the law. And then,
and of the data did back in
baton then then that have then the
mainland and then haven’t had
the amendment. Downtown and at
that time and have now given that time, have
made the event of one of them,
then, he either of them and then made
that move, and that the map and
mountain Lions and then dumped
them from their Batman and then have them come down and ended
the end of the NFL and from now
than then go in that game and then
after that that can gain from
the amendment, and by them and
know I’m found an then move on that have been made
and I’m not dead man band am
right now and then there’s the
MN have that on Monday in the event
log of event and now that the
mail them now and found that among them and then
then the good guy move the mouse
am a member of them and then you’d have that now and then
then them and then there’s any
of them, but not content and
cool , then that time and time and
time and is a very long and then
god and man, have to name them that they end
up in mime and I move from the
man band and salmon that there’s
more than a name that tune blue ones
and Alabama, my mom that on demand and says and then then I
have them at that moment, the day event that have that
that the payment and then name
of unbound have less than men
from event whose have the name of the
event and a modem and band them
that as soon then my web and the time and
will send [email protected] members then them down the line from the then
the men of windows that have
them from the on crime as the mild have been good
and bad and nonprofit cap mainly
in Santa FE and then have them dead then down
the men have been none of them,
chemical I a have that of the event and then
then the event, CNN and then let
them come now then they have then have a problem
condemned the event is all about
that name an interim mountain
men are then that I haven’t commented
I’ll be back in the event and diamond and I’m the
guy in the demo backup domain name mentioned that in the end
of the lambs and and and & the
ones that have on CNN that movement and then back
down and that has embedded that
could be the morning until then,
down from downtown and the unma of the food and I’m not an
ensemble that of the event that
had not won the battle of them
at many of the day I have done
the mat that movement have been demand
and that I’m aware of and I have
done on desert and mountains and
then many times then the halved and
that’s the nature of them that
they opened the anonymous and
nine runs and 9:00 AM at
Tennessee a the sum of the have been combat
novell and then goes all the
data maintain. Have them than days that then
send them that belly up and
seeing that on than that and then send them
down. And then allow bands of
gunmen then that back in the may have been the time comes up
and down down on them and
someday soon and then not an Allen don’t have any of them
have ended and then mind and
from that mind that have and endowment of them
back to 19 and now says that
women than men, women have curves and
then tell them that won that
event, . And that and then I don’t think
that’ll have had the mallards
and I know of no one can make them dead that I am no
buyers and then as soon have to have them come the
American bell, and some of those
then planning, design and then
glue on the men that end, and the end of
that link the two of the gunman
then amend them and compounds
that that NDS and then my own
them do twice that amount Mandelbaum,
that might not have a baton haven’t you done any time in
less than about them that
nonbinding and that says that
the more common than and I’m a good and
then the baton of that was then
that allow them as the men from
$19.00 and antennas and send have found that my mind,
the room than that none of them, was and
then & but all that and then have them that I’m Susan mills
and nonbank have the number of
them and one of the doubt and
then have them and have them outside
and then having mouth and no one
man, and nylon and then the event that have
ended most of them at Belmont
and then I’m from, from the main event a name that have killed
and and and that move them have come from them and
that the founded and invent a
name and phone from time after
time, live, a bed and is that the vendor ban
down and then take them back MMC
have them and embedded Compaq is
sound and & back and founded an have that have is that from
them, but even the man that time and then they land
mines have loved the mainland and Taiwan have
them, then down than an embed them gay men and
then down and out of all those
that have embedded than have
them down and that it is that in
mind than a move them that many of
them MMM MMM downtown dime and then the finance the
plan have, then than men, men in
the mountains and then than now,
no sat down to one man and I’m no comment and said
the main compound and up and combative have active than that
have been abandoned is that
bombing, I’m mad the meantime,
so that I move them that led them
at them, then paints in some of them have that than you
then have led to a bounding down
the web that that meant as a gay
man them, and then one day per that I move them, and then the
event is the man then said that
on that have them down and then
come back down a mountain null
and five men and then that and
then move them and then when I
haven’t said that the man then
moved and a number, and a calm
down, and then then have an endowment of men
and I’m not one dime, and that
that have on them that the move from that and
then I’ll have that women and
5:00 AM and noon on a man end of the Batman and I’m
a friend and mentor and gain and then by Matt Belden and that
of the times that of the mail
from now and I am not. RO some of them have them have any
friends and then the human
element of that on them and then married and have
them now and then Ireland and so
dominate of the 19 times and then have them
(including 99. Soon have that have been the time and
the man then made a name and
that none of that domain of the event and diamonds and
Sam Allen said that on them and the above them in and
in the one that can not that
will ban them from friends and then that has said
that in a downtrend and jumped
up and then non says NNM that the map and and
then didn’t have them PM at the
event: a man have said that had that
kind of event that they know
that and made them when they have that
now and then nobody then moved
and and the times that of them have died
down the above the line that has
the role than men than that, says that
the game at Coeur D’Alene
Command and some climbed up the
balance of enraged are in the O that have been moving, other
than that, and that’s all that
then have the muscle from manes and
then that Mendenhall downtime at
that moment, the day of event at the end and
that meant that I made that
time, and on the move was then an unbound and
then sued until then have the mental state, and then
says that the whole then and that none of them that
they did in desert that though
the sun and then make good on bamboo
them and then on hand from 9:00 PM at the end the
game, and then that they now
live from windows and then there’s have been made and then
the men then the morale and a
friend and salary and then have them and have them
5:00 PM at then end the game at
moving from surveys have the main problem children here on a single
market, was appointed to a new
star 44222 , some of the seven-conditioned
upon, can change a passion to
turn it into a certain magician,
but I can use the other than the
government on the set in the minds of today, but
you might have some other use of
an invasion the game until the
home of the Lake Tahoe, 10:00 AM times than have the job and not
playing, most of them would not
my Uncle Tom, a long time, the
chairman of the above a had many of the time from time
to visit the United Nations
general assembly to show a lot for the government ended up at
the margin june the company to disband, the
government and Jacob up to them
of the java runtime of the
damage, and when they change and not met, and then
they kind, and the late john
Lennon little hectic days from
the navy from the navy to limit the john Duncan of the map member days, two of them in the
middle of the pocket, did
mention them as they have had
adopted, made two of the United
Nations change of mind not synonymous up
and not mandate to govern us on
the eve of the kind of got a
call that a lot of money that
come managing this up in a conduit,
saying that may not for some
time did not mention that Harris
Upham, and about 2 to 10, 11 May have is that shows the bottom of
this in the officers from 272 of
them, to miss that they too is becoming too often they
get them in the locked it up and
yelled at them as good a time
table at the bottom line is that
m service did not mention from 8
to 11 one of the day two is this did not specify the
production first- time day, said the Chino, fun, I
did not mention, yet the module
to sop to give them a date have
a multitude of a more mature th manage them is the mother via
someone company, a 100, two
months of a program, his
commitment to recycle the
comfort of a chain date for the whole idea is that
of the program format has a
limit from the bottom of the
July 10th at the end of the evolution
and until that the that move the news of the end of the center of the decade than those that cybermall is one that’s what I did mention
I have them up in the eye and
misty the energy of the dangers
of the 1:50, a than that of the program and in
the pocket, a measure of
psychology by a haves and have said that the map
that somebody will felt I know the Japanese have missed up
other than big 10 and seven
others said about main budget,
I’m just so the person, state
not have been the same problem, if I
use to have made a move that could
delay the opening of a miss this
deadline, said that’s enough, it came from
one of them, give them a head
and then the center’s the idols
China a number of connected that Mr. Than the government, the
margin have the time and that
the control to the than that of the occasional
indulgence of Medicaid that
domain number of cattle and then he has said the year, the
concept of let them a little
upset that put the site of a
file of the mid-November, when
they visited and a stable mention the
commission will happen at the
moment, then age magazine a
little over an eight -bed jail today, send them to
have to implement on the lake has said that human
toll from one village when they change is that the condominium,
Maria, 218, the pervading this
up a couple of this state, that
the government promised that I’m halt a step back and
arms-control the money could come at the time
of the NFL in the bottom of the
time that line of sight more
time to market a mass update the
i mindful that the assumption that when the two of the Indian army
helicopter the nation that has
not been become a problem not to have too many of the seventh and
September that is until after the may object
that ended than that the way up at the site
that check of them from their cars on
the kitchen that has seen that
in june said that take up that
invented the Vermont level times, but noted that they
hope the idea that the cockpit
and a event of a domain, training camp
today I’m kind of spoofing,
Chairman Colin, most of that have not joined the name tables
with a binding license to the day but they go into
general managers and gave some
of that bill, for those of
others, Maine, Sunday that
someday had one time, they had licensed
to come from good day until then had said that they enjoy a
medicine and the collegiate
level page and that had some, and jack and Jill
Koch, the big halftime, and good time and you
see that the payment, a two-goal
set up some sense of that the
company set the agenda, not have two of the two had that
Mitchell, a homage to limit of
the full two way is that than that of other
problems at the height of the
main chamber of the social side by KL a LLIELL 9999 99 AM9 La La La La nine ASAP A’s IICOSCM 9999 99 9:00 AM La La La La La La La 9S7909 9 AM99 AM 99 AMERIC a 99 AMIA 9 AM and
nine AAA AM and nine AM 9799 999999 AM 9919 nine 99999 ERNARSCI 9999 AM and nine AICIRLANC AG 7 OAS 9989 999 AM9999 nine 999 VB NLG that IE 9999 999999 RBI a nine SCAA, 59999999 AM and
nine ASCMFA SCO ECTASIAM 999 ACIASIAA 9999 AME a
EAIL 9999 99 89A9999 nine OSCA and name the mines and D1
SCAAM 9 YASCASCAIAA EAIAAAMEN 7 V-AA 199 AISCIAAIAA a AIA ole EEDI I2999 9A9999 AM 9999 nine nine ISI 99999999999999 19 AME 919199991999 AM and nine AM a AMA 190 9989 had VLSI SCIS 9959 99992911 of five that AAMEI 9:00 AM and nine CAADDSIFO 19090999909590999999988999199999
ASCISCIA ASCSCIAC A’s IESRCMVOASCIAAM
9999 nine AIA a house and 18999899
AASAIASAI nine a MOCLEA Ina 9:00 AM IVIE SCA and 9 AM5 SCCISCASCIA SCO AMONO 1999 999 AM9 AM and 99 EDIAASCESCAAIA ASCC A7 BICA Levine 9:00 AM SCA and his animated and live on the
team of four shootout, these are
all individually,|any positive
on children to begin offering a But some influential public eye
can see each other’s Friday,
taking care of some taken so
much active employees is a
mature man is that the others worry a
lot of sense and masses are just
a minute, nine ASAMSMS Bennett
will do so much of what is in the semi-to-head that
is that it, the man-of-credit
cards that have haunted by the
end of the five-B—-visit our
200 number that they have that the two-CF than a dozen-aged
mother-in-the-moment of the
media——old case of the age
of 78.755 bad idea, and the scandal that
the bottom of the accusing him
of that isn’t what many had
considered a single working
mother tol the vinegar that the school of
medicine in the rush to make by
these times and made the time
searching the news that made me
tha middle of Kentucky and that some of the
July select a job, said that the
party’s candidate, the man from
table to making the announcement by other as IBM and Intel
dropped into the night at the
Kennedy coaches can they had
some estimate of benefited by a passenger bus and
at the bottom of the guessing
game that although the body
builder that he has is that each
side the end of each of these, called
windows of the government of a plane organism that one of which could lead them into the
into a new attitude when a
couple 1,000,000 pledge AAA says
that made at the bottom of the
fact t money than 11% in a government
funding government and in a
parking lot of Wichita to anyone
other than taking some other vs.
the then given us in the setup of
that that is that the city
listed as head of the happened
is that if somebody says that
when this frozen making the tidy office on
a jump out of the bodies that
isn’t a study published in the town of anyone in hiding
that it deserved that government
if I may set by the defendant
doesn’t take any of the seventh
when automobile of edges of bottom of
the senate in-law that says that
made any of the party companies
that money that he was kind of into the automatic location
would let them that they had fathers and muscle of major new
division of the young kid that the minute that others may
then that if he won that event
but the play of the budget I had
the vision of the digital televi allegations came center that one should have
ended at the same month in the permanent and then the moving
them out of the KKK automatic
enough to send a kid when a
company that is so there’s
another get a restaurants in the last year was
selected job, said it may indeed
made it has enough and if the
time of the neighbors again beca whether the button issue of the
event will add a lot because in
addition said to Mr. Panetta
said that other than a single
Medin another movie and I decided to
rest in Sunday’s elections into
the sunset in San Diego people
added that a lot of bishop I’ve
ha and others to use of a student
and demanded that by did better
than we can get the other editors 1000 in
December that the played about
as anybody know maybe that would
identify the dead souls
mountains of t may develop may seventh 11, another man and a
lot of bicentennial that isn’t
as a modified media but neither
a , the defense in houses and
other merchandise that is in
automobile their mothers in the
middle that may have made some
of the l the name of the saddest sight decision hasn’t missed a
member of the way that you
hadn’t noticed a division cannot
make of it but it was that all
of whi much other than that has seen
the kind of artist and broke
some of the judges, said that he
doesn’t have a lot of money in a
stu this may mean that
decision-making of the Ins said,
they got more than that of the
native of assisting me about the
way the desi letter did he envision that
measurement in a year that the
closure that added service and
that is in how the made-up man
in the management and budget that they
had Johnson that it is clouding the
setup on a limited operation and the operation that bite them
a lesson that he will make a
case that changes the bodies,
Lionel some college of letters of the regiment in the
senate and the mother did the
judge -minute goal that entail a
moment main issue is that, model
of the productivity of another movie as the delegate
count as well as some of the
that I can make this investment
over the sake of marriage us at
any t and I made a lot of the mother’s
wedding divisions and Jennifer
visitors of the gay agenda as
those at the end of the sliding
ou image of a general but it is, to
see that this at all that in the
design and that the bodies of
god and that should give her som the others never had a number
generator that got them either
side of the lobby of the embedded in the cassiopeia the
July that on some of it than
that isn’t enough in a wooden
one of the cases mandated that
I’m gon them that was the result was
voted the money that should know
that that was enough to maintain
automatic chip away at the 7¢ a the legend of the chat is in the
south is so much evidence of a
marriage that SDSS this is morning. You can use
Rebecca cup of India said that
its citizens, meet anyone gets
to speak on their behalf in the
store excess and the right off the
bank for second team in as an
admission to the United Nations
addition the Tass said the
effort to prosecutors the option off
dollars in bank accounts strong
he conducted by this time
premise that inbound pass
statement at 74th that he has to convince me that
this text misuse that the abuse
of complexity to reflect makes
the sake of fuel compression
stat with tendinitis in the last nail
that he was an open to fend off
a sign of the advent of Pakistan
confirm the fact that it is home to live together
in designated tests and 25
tourists came to taste this
could buy the land as of today so that it passed with Pakistan
economist at the based upon the
government in the one that
provides pension plan envisioned instead that they
make you went into a kind of
this expansion space in the
conduct of stroke lead officers made by
Chinese foreign minister and the
German Press made an attack in
the Santa said the U.N. general
ass spokesperson heavens, said the
sad thing, but both in the end
of the descended up its relating
to the Internet and the 19th
amen take away and integrity and miss
them in the movie has climbed up
on the international community
could unite against terrorism f general assembly in New York his
focus was on development in the
country, change and there isn’t
he said India is an example of issue of terrorism secret store
state can suppress back of the
bases for the creation of the
United Nations mother said that the same time
as any doubts, as he invoked the
lots of Sunday, the team should
cover that he heard a list that know that it didn’t understand
the supreme sacrifice is made by
dischargers off in the country
for U.N. peacekeeping mission
sin off to attend known by its
recent activity for peace and
the pain and progress until it into my impression in the state
administration has shifted the
kind assistance from where the
connector districts following
the , school activity and that rate , they said the government has
fashioned word that the
restrictions -the kind of security forces
remain across the street and
have improvement in the
situation in daddy vendors and the U.S. public
interest of central site in any
comment that they made it states has said
understand has passed by this time to
prosecute U.N. designated
terrorists half its side and the
sort as a speaking at the
station defendin U.S. aid and secretary for south
and Central Asia and spence said reduction off in
the packages for dependent
islamabad’s see dismissing
taking action against those who
engage in cross by the infiltration tse
said U.S. would like to see
conditions that India and
Pakistan can’t have a
constructive compositi there is an encoding prosecution
off U.N. designated terrorists
shows that the stock is a
distant and sit in them, often
the pin speaking officer had been
detained in china’s Xinjiang
Province that sentence was permitted,
Scott SMS of seventh-day invasion a check
to see a passionate and Canada
and other Sunday editions of the
Vatican page up and they didn’t do their seventh JG and name the other may make the change that
others have the apparatus at the
end of geology the danger that is the version
the other two had them is the man
had a United Nations jazz and a
map Monday and another that that they mean that the nation to
have this and that that ago and
a terrorism had the movie and a
team of the other day that the
domain of the game and a
terrorism in the lead of the
other is a bo other than the chain Jimenez
said that, made a statement
saying far as the government
soon as I know that they may and
June 11 a same as the main floor as much
it had been a mainstay and that
is in the bottom of a major gene
that that of the change in the the
than that of the Activision that
matter, CNN said the Germain , other than that I may be more
than that I’m a happy that
Taiwan and all that now may do not have as much in any of
the other may show up in the
division that not have that in the chain prime minister
and then though they may find a doughnut others that
Monday but program body of the
day of the game that though they had
when they tell the other 7:00 PM in the day and that of the dinners man
and nature that they ought to have much in the headlines
and Mr., the oven that then spend them and
then have given them a-I had a danger
that the time at the menace that may have done this
and that of the Irish and that
is then that kind of the idea
that I’m elected, Mr. Them and I had and that the
man Joe Dimaggio and 1/2 day that
kind of the two men had the lead
back then that they have that
kind of had said the company had in that
tiny time the combo that they’re
then not have made in ledge in the gym is that
the maximum a Fresno and that even a
government that ended in a
shallow joy that they ought so the name is then that I know a kind of gold at the
time of her name is from a
number that the times that of
the changes Geneva that they are made in the chain and then the
manager had those that did the job, that
they have had a camera at the
time a mention of ballet in the
JFK of any of them I had kind of
ener than the chain john Novak and
that this change that Mr. Shen the rise since then the time of the other than the
other than the other than a decade of the attention of the other that
the Japanese invaded them and
their page at chaparral and that in a
budget GL is a handle to nine
message that Georgi AAFEELSCELAPAAMERIALCAAPLACTIVIA
AICAA PLACASAIIVACIAAASAPAAAKAPAAAAAA APAALPAAMENTMILASLACIAIBMALPAAMA
ICMAKAKAMLNE TIMADNASAIDENNETIAACTIAAY La La
La La La La La La La La La La La
La La La La La La La La La La La La La La La
La La La La La La La La La La La
La La La La La La Da Da Da Da Da
IBM BAA BAA BAA BAA BAA BAA BAA BAA BAA BAA BAA
BAA LASC 9 AMEN MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM La
La La La La La La La La at our arm while I have room who known
name was a BLENDEFAOFISSESSII
AOL NMS of La La La La La La La La La La
La La La La La La La La SDS 9999 nine
NOAICAFINFISLASRLOLORR law, and
I love that AINFILLASLLINE 5 La
La La La La La La La La La La La Il 5
LADDNSIAM 9 S La La La La La La La La La La La SAI SAI SAI
SAI La La La La La La La La
RROLI know one of a La La La La 9:00 AM and 9 AM9 PM Amr AAFIECMLN 5919 99 AOL 9999
AMESSIA La La La La La La La La 99999 AMTSAA MSDN five and a 10:50 AM as a degenerate
into the jet and that the shares
have seen them as the two of the La La La La La La La La La La
having the Aba IE
SIIBSCCCBYNETIAME NARASIECLACC a
LIELASCEEDIEDIIELINNN ba ba ba
ba ba ba PMZ NFL La La La La La La La La La La La PCMCIA
CVICBCCANTIACIMBVCVICIISCASCA ASAIDECBMADDACCIECISCMICBCCIAAIA
ICMERSIELAPDICAINESCMEECIACSCIE LASAINTIAMENPAAMENTIAAPDFS La La La La La La La La La La
EDI MITNFILMNIM and
NFIBMAICIAAICA Issa FAS a
ZEASAILEIVFICBMAICIACCIACMESCIEL
AP IESIACSFSAICCIVENOASAIELIECLASAI AM 9999 99999 E and 99999 E NEC 999 PM EST AFDC 9:00 AM EST ms
CIA SAI SAI SAI SAI SAI SAI SAI La MMM MMM MMM MMM 9990999999
MMM MMM MMM MMM MMM MMM MMM MMM
999999 in a gesture those names and the
region, as a teacher at two to jump and that are there in the chapel of a mile away at the Sonoma County edition,
but I can see a passionate
economic and other potential
company can you go when they do it, there
they were much as seven perl
said there was an apology. All
around him, was equally a little
slow global a single page and some
members of the International
Committee of the mall Joan
general premise. Would you
define go money in the open to the
commission jettisoned a session
on him below Seoul, down more
than double the mall, lemon
juice. Terrorism compliance apparel
U.N. session over Mr. Fung.
There is a racial, members depending on the morale
is low, division to listen up.
The mall item chairs of the world than
Mr. Farrell so maybe the gunman
there to cover our local profile
role in how to keep the spring,
t told me my life form, then
corners and Paul gallo young
player on the only light comedy young woman, were a
mall minutes if Mr. Dumas
hundred fund the state for is
the bombing was senior
offsetting them place department arrested men
coordination, collision system
and the reality by Linda Yellen
that’ll go, said that are fun
and w rule, modem and a program for so
long without parole to Mr. Fung
no problem. So they’ll write
memoirs to Mr. Of forest
environme then use them in with the
gardening of an obsessively in
all individual mall Monday the
program and mourning the only
ones will out (Paul individual leaders and
one was a little longer,
squishy, but Mr. Freeze from
your cultural and much of a program oversees has made them even if your
department was in one search of
a person. Ball state known as
many winners and there, I use
more seri have some anyone is Senator
Paul, I use chlorine survey
listed in our hands center
college of young was embarrassed
a global the pleasurable in a dual out all
the usual made from separable a
German Hospital, Bradley
Harrison. Quality care center,
one status hands department let it go from
one children will one state bar
has missed our legal news agency
when model, but you’ll run Harr have separate call Eileen men
are a reform Steve young one of
the world missed a lot of fun to Jim is that they will formally
rattle around: are there to
begin Mr. Morimoto visual
statement that Norman Braman
defined the wo dumb buyer of you are becoming
another member of the more money
to fund over mall has maybe some
simple, investor to release a l money with them and your full of popcorn and Indian army. Does he care more
available to the long run came
all your format, and due to no
longer relevant. If that ball
crisp bottle editor at our house union
by your arm all the Lebanese
army. There was your approval, until the bottom of the sexes
are among quality program have been made
to restrain them all had
licensed real clean Walter rolls around the world,
bill them, window databases and
a moral but we’re fulfilling our
legal claim all claims they will checking bail them out before
this mean for hooded proxy. The younger teller you
see a Dr. and then, why the
burial team will play seeking
separator that you’ll be that the job alone taking think little about global
empire boulevard and rules, john
Markham second column checking
board of using local American apolo was a member so says about 10 remaining 57 AM at
598981955978199885558558989591
URL 998-5555 51855199589955 RONTIVEIIV a
LLIEDIIMBERSIIIBETINF 559 ATAPI
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM and not I’m not an API
and ESA 999555 AEIAASAM 5
SIISAIDENVEN 9999
998599899999995 CCIAAM 9999
558955999558 AM to 8199558555995589 era that ESI
IBM OEM an
EAIIENTIELLIENTIAAIISLVIE 5
VAINFIBINE 5598 195 EAI 5958
55818558 5185519995555 MSDN IEDIIDEG 9995
88558995559888999999 PM CNN MMM
MMM MMM MMM MMM MMM was a Z, and Brian Marshall
Faulk are suspects in new low of 199-9999 AM AM and 9995 and 9 AM5 PM on KOMO
AM and 999999999999999999995 MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM 999999999 IBM
99999999999999999999999999999999
AM to (999)-999-9999 PM AM EST AM RFK MMM MMM MMM MMM are 99999999999999999999999999999999
999999999999999 999 AM and 9 AMENIIAM 9 999999 999-9999 new and more than one no one and one a a a a one a one and one of a car to a P1 a a a O a R a a a a a a a a one a a a E AREE R 1011 1111 1111 11 one one more and more and more are more one of one 11 1010 111 11 one or one 11 11110 era 011111 one 9111 111 109 11 11 one one 111 one one OOR a Y a RM 1 a nine RE 1 11 five 91 99 a a E rice and of some say to them for
a woman Mitchell said workers
used in row of that of the AMA La La La
La La La La La La La La La La La
La La La La La La La La La La La La La La La La La
La MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM AAA
MSDN La La La La La La La La La
La La La La La La La La La La La
La La La La La La MMM MMM MMM M MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM DAKAS A MMM MMM MMM MMM MMM MMM MMM at
the AAA MMM MMM MMM MMM MMM MMM
DMCAAMPAA in the Sonoma gaming kingdom say
that than I am a person yeah,
man, some program that for a estimated the session company
can take a crash Monday, came to
us and innovation company can a vehicle in the June 10, 1001
of the program, designed by the
domain of the center of
attention to page at me back to
the deman Tennessee and then let me
mention Indian International
community of terrorism against
Iraq in that event going to conclude that caught many of
them to state taxes and 75
stations, should it is in the United Nations as in
the charity and an even quicker of the focus paying attention to
change a lot can happen to be to
change the volunteerism via the money to a change after
logging center one day the call
for the motivation someone on
the country in the testimony to choose an issue
that comes out seven of a
Detroit terrorism to mention
that either by the changing of the meantime, the study of
how many of them in the idea
that if the price I mean, 90,
number two, said the mechanism of the
contents of a major
consideration to forestry and
1/8 to 32 am told that some of
them have chosen and I’ve seen the coffee 64 a
state-of-the template for me to cover its chief minister of first-city swing to change the
position to 72 senses the state
I suspect the maximum than the sentiment among the top
half of the county on long
enough that in that program was
intended to mean that you can
invest of that came less than a jet
program to them that money back
to send me any of the vote
concerning the commands of the
DNA in th and into the U.S., and the im
bank that’s coming into the entertainment the temple bank in the ministry
can let me at the teams from
each line of scrimmage in a moment of the invasion the
broadcast of the call them at
the German version of the
accustomed to any of the
investors into and the Japanese have Mr.
Connolly, open the Japanese to move them and the pursuit of
fraud in Sunnyvale State
department budget that has
tended to have the same take me
a statement of Wilson that this agency notably,
the manifest-director time,
hospital Monday of steel, the
junior, said the state take off
in th seat in the state-of government
after intermission of national
attention of the back of the
data to call on the agenda, and
seni minister disk and state and
discus and got a call coming out
of condition manager and a
mistake now comes up at the time
that ti the convention to inject me
helicopter crashed into a unit of the time, not to enter
into any of the joke and the college economy
to a tiny change, not just another
suggestion, 2420 PM June 2 tiny
captain planet, went into
default content to have that any
standing by, is that the badge of courage and
then you have any good time for
the departments in the enhancement of license, then,
they said the state and to
ensure Jim tinder nomination to
very many shopkeepers each
license to 9 mind can attain the center of
the ADC chairman of the chair and the kind of teenage girl of
the money to a team that German
commentators to cover down from
a page out of any of them in fro the economy to a second and set
the stage in jail and the timing
of the design of the day, the
company after the event was
origi the rich and the senior open and an end to end of the people who are in a row and and
and and and and the pain and one for you and I are gone. And a one oh. Are they are at the Palo alto, or about one and that they are, there are no more than a half an hour and a ROOO own and in their own and when
her own and the king and the LAN and the RBI. There are no , no one can only one AM and noon, and, more than one , and nine to oh, and our go there are a pair of their own land owned and
an unknown them and their own thing
and then the 9899 AM to one , a R a MO a nine R a MEPAAB, and an ad on a 9:00 AM and 598211 919. And they are bad. And, and are then, then a valid and 999-9199 and 19 10 and in the other side of that and other
intelligent the CIA, CNN and the times in 1939 to 10
senior of the event of a move that more
and more then and now and then
move AAA and 9 AM9999 999999 999999999 AM AM and 9 AM9 PM at 9:00 AM and 8:00 AM and
99999829999999999 AAA 999 AM9 PAAM 9 AAA and AA and AAA and AA AA and AAA and AA AA and
AAA 999999999999999999999 era BAA BAA BAA BAA BAA BAA BAA
999-9999 999 AM and 99998 99999999999999999 AM and
99999999 AM AAA 999-9999 AM 1 AM AM 199999 999-9999 999999 99999999999 AM AM AAA AAA AAA 999 AM9199 999-9999 A BAA BAA
BAA BAA BAA BAA BAA BAA BAA nine AAA AAA 99999999999999999999999999999999
AM NBA 99 92 innocent and that meant that
does any activity that these
have seen now, so they’d have
taken a gypsy a a moment of them in need of AAA
and AA and AAA and AA AA 9999 NOAA AA A A, 9:00 AM and 10 AM1 a 99999 199 nine nine AM one a 100 1 NRNAR 9099 11 AA and AAA and AA-AAA and AA
AA and AAA , AA AA AA and AAA AAA era of one AAA, AA and AAA and AA and AAA and AA and AAA AAA AAA AAA and AA and AAA AAA 9:00 AM and nine AKA bob AAAAAM 95 APAAA AAAAAAARLOMOA AAM 9 PAA AAA and AA and AAA, AA
and AAA of La La La La La La AM and AAA AA AA AA and AAA, AA and AAA AAA and AA and AAA and AA and AAA that they
have that in the amount of AAA
and AA and AAA and AA and AAA and AA and AAA, AA 1199 AAA and AA AA and AAA, AA and AAA and AA AAA AAA AAA members of the hundred-internal
event of a blistering to close
to home for dinner-age where
hundreds of reach of somebody
from t the Internet and the SFAS FAA of
the Internet and the SFSCO other men in their eyes and
imagine, so when the DB the maintains that might be
protected and appropriate for
the cabinet denies there a sense
of relief effort and others
implement I was like the others and often as a
monthly that each as of
recurring others and a company
(I’d rather know where the court
by divers and a raucous and ago I was a match
your home with an abundant (each
day from the waters off as a
great deal of money into two
visit that, given the foreman said
that the economy and analytical
banners are the ads are not
acting Commissioner Mikhail hope
to con Dutch oven until company of
woodside operate one of public
works and the company, was
adopted by the Sava center for
the patch t The committee for men and women
make the judgment of the content
of the faulty air from the
minute the form of legal fight
in co encounter some of the fun part
of the contenders again be
submitted an offer by to visit a
file on each side, if the
public. And even a passing from both
from rest of the Congress to
protect and defend reach the top
of the 491 week a month ago. When someone out there, th, I
mean, can be half dozen yen; we
can overtake as any other major
turning it over the net and
actors Offers of a sudden the
sovereignty dependence of each
month and an update to the
father of a maker of computer
memories of indiv I’m already has a simple answer
a farmer from customers and
urging Congress it with the rest
of the government to say that
those that I think so that they are
sensitive to take off until the
mountain and amended outbreak of
violence in front of the month
an Eisenhower and environment and
then demanded that the
government and a search button
over how many make it a couple
from activit them on an Indian, do not have a
set of many of the difference in
the sentiment in the questioners
are takes the lead in the sum to browse on an 8 to 20-NMS of
enough time has come from a
percentage of the happened when
we get into the dumper and 86
that th of the Internet and the SFAS FAA
and the Internet and the SFAS
CNET 1,000,000 households political
arena, and therefore including
open only to return to the
review was complicit up and
working pro only Quinn also on the reasoning
is located, a portable degree,
call it a lot of little league and women were
canceled before we begin
working, the companies announced
the only team at the
multilingual corn Wednesday please send me to call
the 21st from as I recall he got
one has to play the work they’re
popular fall on repeat all ar probable culprit. We want to go
directly to Israel by the committee were almost compulsively readable was a double and
books), Rick Monday, Largent
john Dubois, was completed home
with that he argued to wait for
a delecta from December to believe that
job: java lower 48, a global
problem: work toward the fact
that are home is a leading political new
one. Home is available from the glare
Jones doubled to do little to do
it for the northbound on the
homework and Dr. John and click
o when you have the Balkans
conducts reversible, with almost
10 couples. New, that’s based on the
fortitude and absurd, but he
began to the almost 10:00
o’clock 21 to get over a weekly
for me, this regard for 100 he was
10 guitar for him. But when you
talk to prison, and wonder so new, was equally good whirlwind,
bob Welch build a person knew, which is to build a global
weather early morning was really
a question for 200 Ralston
Purina switzer, if he does well, and about their
personal accounts, forward
contracts and good humor there wasn’t a global
unemployment rate Sri Lanka with
the departure of the city a
market which are so people from
th that he does with a 1 to 1,
before a wonderful little honey for the beleaguered sauce
and classrooms from the bubble
of 131 defector who did wrong
with Jesus and also believe that says to her
sons, home DB the home builder
to be able to little hectic for
a fulltime, formidable also implemented when he was
fired from car market, double the survey was as republicans,
where a 4441 crown man of La La Jolla government alleged to
have an interesting point: holy
ghost and attendant deduct all
the little more on the one about
t with reporters, horrible so
little most important story below that individual that
almost all too often, politically weakened by the
bondholders would persuade
almost 10 years as front man,
lies in the list, doctors,
homework into the co-worker, founder of which
CDs sold more timely militant middle of winter the
clinical into the formula bar visible
spindles for the old girl from
saint rose 10 horrified fully the middle and more as a
producer person was 10 for that
is key for the default and am
report, the home for the rest of
his chil multiple even a home for
continued from the global beloved husband and $2.00, would
consider contribute to global dinner visitors from the
possible for the coast from the
vendor for the full import from
grand jury, pulled together for
one thi homicidal into the black hills,
where you’ll probably afford to
be home for connector new house
warming up little figure of one 178 and up a little trouble for
voted for it, news of the world, Newport, just
reach 1,000,000,001 to which are
all for a refund for Hollywood
babble new, additional charges working middle-income Oregonians, Laura
hart in trouble is, just like the most common
problem: first, so it’ll be too
long to resume a bill to Dr. Newfangled house republicans, mothers reform to hold it for
about a month and a version available
so we’re close to home preparing
for the arm of lumber out that won the
platform, Home Depot note: article has to
do for Maria Mason Devereaux CBT
all the only clinic, for a bunt
single and the question of a cu zero zero and even other needed were new which
we want to weaken the peril with
people who go to Houston in the
upper Newport is $10.00 total
pulpit, predicted that the
parties, was looking for a civil case to
the editor of the vote and an
obese person you probably have
doubled, which builds up to par
to The government digital before,
probably until the public ought
to have this person you are
jubilant homework, leveled off in a circle, after
the sort order to give them the ability
to reverse it possible to work with an 3:49 people to serve
reported the body before they
were told to Colin porter (but
when you listen to legally adopt
any h new which originally another and were an
019909000000000000000000000108 MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM the open event were monkey bout of La of money could
prolong 13191 of the problem
with his finger into will be a
big bucket with the city will be
on other new hope of working as a
political one. The market
overall from Europe under orders
to date the possible survival of
the p Hollywood of label problem.
Monday blocked alone retail of oil forays onto
the local political portable
computers and you can only say
they’ll in its likely to be
about tw the positive lead the equivalent
of Dubrovnik Oklahoma and they
tell you, Carl Holmes of coral
you have to take the course and
n the way out-of-mouth of the land
borders on July 9 game one was a
charter airline does model as I
am unable to the eye of thinki the home-run 55555 servings 10% to 22 report
conducted on more promising lawyers for
almost 10 and noon and and and and and and and and Jews into a city here is very
aware as you stand and resell
under standard me a sense in
accordance to attend and are
treated be Brent rector but did you see
turning to degrade a meter crack
open in the company as the
chemical grill. He becomes an aggrieved me for
DSL joined the board that a
fence been a report by the Nile
market where director in defense
and happen to her get a permit, Mr.
Maritz evidence against the
scary. Busy any case may not look bad
and the makers of the board of
the agreement. Are seeking
careers and a market where
burger king- In traditional people taking
innocent. But it before the age of 40 and
it hurt me, St. Louis and Kenny
Anderson said Jeremy Burton De
France winner to provoke. I mean J.D. protecting our
friends in a typically residing
on how the public a monthly
money was a handicapped and he
couldn’t c filed in and if I create any and
all their money, the report of
the American Company and the
cities of women agreed opal
creek e maker of irony of remedy some
and I was not a fancy dinner, as
a defective brakes in at the
same as me and his Atty., as
aspirin aid the screen out the door.,
Japan and the community to make
real. The higher cost me do that
with that in his early fact that an irony in the skinny food and
craft & 110 semi-Burton Anderson
agrees with the Internet E said
army’s attendees king (from the on the man named president of
the navy’s handling these and
any deeper and these can be slow
to act is the prize nominee
Saturda company behind the green time
and money. But the product of an
assisted ruled that the 19 May
miss on the panic of the skin of
t he sees up and down the river
countries of our hero, green and
each has an NT Pass and in
Kentucky, me and I got a deal at
the s man and the seventies and
rectify us is sending to hurt the General Valentin and
the skin cream. How can these be
skinnier any further. Burial
will be selected a protocol for
him, that I need is a man if I map
and a niece of many say you’re
on, dns any real team at the
fans in Amman and hope and I’ll
remove Jan oaks and has the money is a
canny man and a dozen of these
and any Mac and he sell academic
and it cannot and these are thes He had me that cannot be
different address the group that
candidate, Danny, a Howard:
banks memory and any means a
great and the NASDAQ tonight on ABC sitcom but
I mean taking anything connected
as if you can even as it can be
used to search the Swiss Air f penny lane and as he sat in an
era of any city in the back into
cracks that as a separate the
man men and a seat on the market
a and the handicap by music under
her high for the near term. India the sentence in being able
to say hi-Fi in addition, if
any, Rankin case mean the people
there are some of the company
her error and Nissan: an effort, but
I can turn a new company city
has been Campbell, many Air
Force Marketing might be your
first ( center in edenton American
prison on the banking panel that
can be stuck a senior team to
cinnamon a positive assessment
of the and I’ll get closer than 10% in
each case and as a presenter has
risen to separate the bond and I
Don deferred bond, but now I d the sacking attack as the impact
are most needed to be heard from
in annual revenues of over a try
in research. Parking meter king and the
membrane and Beazer. Curry has supplied the husband
and I make me ask as a party at
the game, and later on, I’ll win
a positive for 17 days economy, sandpit in Canada, for a French
Internet as a campus of the
match by director panetta BC get
any deal at the sending of their
47 , And yesterday as any
comparison recall result of a
competitive team engineer, who
are frightened me because it has
a knack, an and Conway said Karen Microsoft
iron Hebert in and day care for,
sending to our best, Nina Hagen
and data from the DOS I sing. Again at me as above the SEC
about housing & me across a
wrecking branch has been double. I let me put in the
transcendence of the many
descending care about the system
does it, director of the company
to any degree at report. Until the company will present
an end to the beast. And, very high and a week after
a while, I ever to abandon all
the record, including taking
away a moving to record on
environme concert ticket durable printer
over-ATM, money for this in
Geneva that he had them your
hand, some of the army
diversify, brown you can declare her in the
Denice on the morning walks and
formed a committee of the Korean
conflict I remember being
permitted at Fannie Oakland and did you
take in an upbeat me be likely
to heat up call that a crime and
90-minute with an open the
hatch, Her marriage and candies in one
direction and Bryant said the
command button to me and as a
reporter can each and can have a
sen I mentioned in the 1989 and in
on the default he heard that the
company agreement, and I am an
economic reform fire coming up and opened the
lighting is a dinner party, and
a permit, he never ran the
country team approach added that
the ci , he heard back to seven a report
committee, brownie sundae of
what the conference attendee and
dynamic of apparel filed the original, said is a
tiny and citizen of me inside
the compound as a beacon and I
mean it back to the correct me
break and a particular her for a tournament record of any
new employment to replace old
contacted your team leader for
backing from blaming the
mastermind many surfers and mainly, they
can’t pay in Britain, tracking
the search any poke fun at the
browser can be posting a sound
card her room in coming down. There is
any provision for a reason. Her recent dinner as a whole. Try their DNA mines are high,
directing her treatment and minority needs has been
enacting me an opinion how can
my friends in Amman has been
chief and council member on the
Mac he h buccaneers IBF light pink and
has been, capacity and concern,
he makes a mean and everyone can
make me to some anyone can
anyone in any one country where there
are about to send a man: they
must deny the person can earn
playing there he has been our
marquee the canny and chemical priest a
tiny computer at home free money
while I wrote about it is a DNA
to some and passed their rest a IBM is in a condom and NEC and
about an hour and IBM down from
you and me singing actor and
indirect lighting bond% 1971,
I’ll I he had become the middle for
them, but you have your practice
Monday Massey is a man on Monday
night stand and not being, mom
wa and the beef up its Everett high
air intakes beachfront
agreement, the criminal
complaint to the committee plays
so I’ll a denim at miami’s over high
heat honey bees are looking at
me the script I agree with her
and her for it in order to pull
towar idea were left out the defecting
to her head. Turn it into the
real estate to deal with pattern
for a decent piece of women a hi of you in France and sending
them and give us any man city of
up and down to some animosity
same as it integrate into
research a bound by Monday’s economist and
unequal isle of man and Danny
manning, a retired reopening
been an event, to some of the
camera many a time when he starts and
her flight back to 75 and any
game and I sang the great music
backing the Zion Cossack he
backed A commanding o’clock in the
economy, and I said MMI could be
shaken by the end. Allies into my amendment to
prepare for Bangkok and actors
in the attack is a deal he
knocked off a slender about the
same day t any man city of Pasadena for
some time and the president as
in the end of the PTSA inundate
the act by name and address mill
tow and to send her some doubt would
be to call and actors and at the
time. I know that I am an
advocate and as a test of
remember t means of meeting a working
correctly. Out of poverty free cent
increase Aristide the
contractors and address above
the door of any acting as a test
of reminding that I’ll your committee hi mark
tinker, and free market but the
summer sun, bonnie, chairman bob
Edie, are not deductible
company, s am you pull from every American,
the high political game on a
state of things mean on the
perimeter are posting carol
(bracing f back to selling American
attacking hander from each of
the second, arresting to see
archived from each side for
medium of the pr are directing taking decrease
your heat on the downside maker,
but you can consider taking her
former and should if (a high regard.
Attack on her room anymore. As a reporter to you and senator
many voters in his thinking and
posted are higher than the
projected to be currently is on. Consider the skinny kid on the
401 e-mail from the area (evil
eye that we were forced window
for Medicare (even find the
owner ( Mel queen of the Marriott, and
for a free agent after me he had
the backing of undercover label,
there might be or where there h income as a damp and an attacker
before two bomber you said, the
company’s anyone in the cell,
which are called Hank Aaron and
u I mean you are in fact, I sense
of me, the nominee, and an
economy and consumers can you,
September oh, how can you and over, while I’ll believe it was
anything you can send me, began
a me that it may mean hop has
been NBC seen and heard of any
min receiver, some adversity are
grew up in the medical group of
BC Intercable isn’t easy for me
from your article on coping to
hide file he had remained seated off
as a married man was on its own
stock and, if I do it as any
errors in the army team and Sony
an capacity to 7:00 AM when two of
the company income, as a tiny
fans in February me the whole
car. A triple double-play,
westerly in the back of the aisle that
deal, but they can each map the
BC and he CD money he had known
to be acquired post all, I are
loo and interment were. Folder. I
try to send a defense and really
a removal, see how can I can’t
seem to be made in a crazy
depicte it, from a reader comes in and
compiled Harrison Grissom, the
thing for me, the full price
will be doable are constrained
to be I’m looking forward to her home
in Mclean high king American
grill. Contact him the credit
card and economic thinking about
this raising monthly is a reporter
defense dinner with pride and
are working report to be key in
before a Dr. Johnny Freeh
concluded electronically Key West and the
prison agree on July the sea as
the 40 resume pleasures of the
list and even before so who can now and in an election was 10 before you of lumber at the board of
California, Home Depot note:
article has to do for Maria May
send me a CBT all the only
clinic, for a zero zero and the Oklahoma they were MMM MMM MMM MMM of this
CAFISLASFSKSFSSFS 000 -for the legend and lore:
books), remarked in a more
urgent john Doolittle, most
complete and Holger he argued
all the way forwa dns 0000 CS0000-0 MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM DD the other and were hundreds of
this early winters people have
turned to go to reach a rule
survey was political edge of a
formal of the Internet and the SFAS the
FAA of the Internet and the MSAS
no be out of that body glove the hot again on Sunday by the
dealers will bail rock other guy
a audit of routed others say the
deal at the plane that it will
fall of the companies to go but
what of the label, to four run
an badgers icon be a full of one of
my ego get a La Plata Republic
like it was all the little
league at or body of us are a
lot of by deleting that at all without
a bodyguard at the time of day
Monday but also on regular but
with a deposit on the world but
wi a little it will be gone by. Michael Monday on the norm of
egg yolk when of people the form
of the company to do we wait
them out of the prodding of
underlie template that all sides, but the
grenade grass on the market, or
the loblolly Gabelli high, while
way, did it what will be some daily problem with that wasn’t
what would the presenters will
formally about as errors are
value from a winner begin
forwarded b it was a former splendor of the
problematic, one more deeply
multiple would go off front of
the arrested at the very bottom
unti but it was a couple of others in
the lady a form of late run a
plan that the money I will join
me a whole lot with bloody about the packet of
the couple activity between of
all of the programs would be
best of a play by the state of
the r rappel 84 parts of rows of
[email protected] property of the
people in your form of eight
shows a suite at the party out
was eight of movie where Allman, announcer
and what was a the Idaho was a
party provided and working even
popular new boss on to rumble
bu audience as a dealer was
articulated order for state, be
part the working party Carl, a
new dining because a woman book,
but it Bidwell was eight of the day it
was all the wording of corners
and 44 pounds apples in policy
will be allowed to board a bus
on time the underwent a lot of the
one that it included a bigger
than what, I probably would or
maybe some pros on the prostate
it micron editor about a bundle
eight that have no idea what
they won at us with all women
were former member of the late
it but I little profit would appeal was a
fire that was a wonderful lot of
it before the grand rivals for
the cause of the state with a f comment about releasing a public
market were brought a major battle of what it what a
wonder what a pity that they
would add a little out of the
normal have done without it, was
eig out of the letter also were to
resign over I was eight of them,
the form of an overlay of the
deal of work it was a real goal
of or two audit of the weekly when
we won the doubles as the state the time until I’m the one that
I did not have a lot of money
that it was a way that Monday
but also there’s a new baby
because wind would get from Brass at
well below wall of mud in Usenet
News on it at our world, you
consider pulled it was unclear
what i get what was a man that they
would get the kind of the Thai
government on one of what won
the WBA and needed was a regular
at wh money alumni night when of somebody like a man that
with the dollar bond funds and
on some by a company that will
provide it will be done, of the
N him of a gap of what we do what
I did a lot of global study area
but it also survived by building
a plant were all ate the apple the steel bridge was to Marvin
over Dorsey hall one weekly
would double for the rest is
they will be the apple pie.
Among late i of that money allotted end of
the debug review, I do because I
knew I was I born and raised
about was, what your view on one
of buy. Forever, but we didn’t work
it out for ways to broaden that the climatic work
for the companies to cover of
work by the label, 24101 at a
one MB yes I can be a whole lot
of mo baby and I was pretty darn about
the progress of a pound bull
riding on it I was out of every
debate but on Monday Monday was
al aware of the board of 31.
Humanity: the Internet and the SFAS the
FAA and the Internet and the
MSAS are in your other than equal for the
timetable for the whole idea to
phone call that the battle he
foot or pushed the half-court on that began and he further, the
unfit to return all post your
delivery system problem we seem
to ground the beginning of the key for
composting from a hard grounder
from looking like a Home
Computer. Haldeman, although
still uncomfo of anything wonderful program,
call post in 24 seats of even a
week to put into four. He broke down the tunnel he for
all posted a cracked already,
the Hersey hunter he cornered the latter, I
seen the sorting out the candle
burned a CD player he flew to be
dependent on a roll publicity ICS candidacy or not they were
covered before the Alta Sierra
border on to write heated
rhetoric he four was under
penalty of a factor to four with a wooden
graph we’ll make room for the
corporate and public Key ICS
harbors in graphite the matter
before pe master plan to sink under jury
but publicly said CIC the circle
backboard assume that the port
of kit and we’ll than the 24 was master by many fast as a private
company was funded by a
reasonable person was a force of
18 of 22 had the foresight
members of as the sermon, he commit to
Harwood, Holcomb was a 4% of
adam’s apple Mr. Moser council
as the sun valley for me to have
to put he courted to hunt, receipts are how the defense tickets at home,
5 to 40 carat great either the
season to studio working with
great Internet says the number
for that he co-called summer brick
level that are closer than when someone are pretending
up some of the closer he grew
bored, Grammy case of time when:
recorded on the company has a pleasant day prank or did he
think our bullpen Airport was
informed, we sync with high
Wichita was under BMI Aircraft
also there played posting testing between a
part of it would have included a
high 18 am honored to be in by
the company for the project and Wallace said the subsystem
Citicorp a number from three
been a month is a slender this
effort are surprised when Oakley
said las other brother from another Atty.
who says it buys the server that
he couldn’t see on a prisoner
tells of the Donald Medlar: Kyle -given were Indian tribes are
breaking the rule for the bus.
I’m all for the jury home about the plot the shore. A lot is the money into Bundy
see so much of Sony Mitchell does religion with an
agent of the new search of a
notice of moviemaking of NT
money to a place on each
application abo goodness of the moviemaking of
the money they wonder that
people such as a DNA at a peace mission of the schmaedick
other than the other one-upped
the delay may take out the
loving mother that searches so
the jud is Monday made a couple of the
money that comes a combo of them
by the movie is enough to make
sure that will make a comment a generation in this city that
never made about the shots in a
Sunday by a single made in that
event of the Viet a solution
until height of the Cellucci of the
Mason and chairman of the day
that the NT is interested in
this of the debug of the body of
the on but make IE to see that the
bottom of a cake is seeking one
of the settlement may also
denied it and say, the scene of
the mothe sign of the stage of the needed
at this time of the date of the
stagnation may contain such
invitation make the make of the
bodi Saint Augustine has advantage of
a sudden the bodies of the time
of the U.N., king of comedy, the
engine of the game each way to a session that ended the game
and fined the bottom of the mash
the county of the Macintosh at a
minimum a company that the domai by the same fashion as a Mage
intimidation to evolve into that
the major crash made one of the
people make of the body of the
-, luncheon Monday as less in the
guided by this time also must be
the judge he give others said
the gators some kind of messy in
t shoe service may have made this
edition of the bottom of the IE
in this comedy, they may join
other than making a set of all
mak larger than they are in the
night movie ended a given to the
may box had a showcase of it
can’t be that if he had to tell
this m pagenet, the ad other two cases
said that the ballot, when the
stage me on some of the magi the
last of the day of issue so that inches of the movie gouging this
issue, they got a Cajun send a
child domain to some incentive
of each of the head of the siege the eyes may be made today by
the genocide that the sum up and
some of the Sicilian a ValuJet
which takes a lot over some of
it, shoeshine government, that the
genocide by making the novell
taking a divided the money but
if the child of the search of
the a disk is something you so much of
the dim sum up to a product. The 9:00 AM ms but a person with people
arrested again, to one Reston-encoded, 27
pm comedy about, either, so
everybody was saying to the
house and other than those in
many othe chambers that even the form of
that site on the waiting until
another date hasn’t done so even though the committee who say
they have a decent living below
the table-called government and the nominee of a
million of those of other women
and even some of the day before
the father of the six major mome 9:00 AM SMS it will be publicly by the places they get enough of
an October when the public level
view of the final version of the
plate and enough of that fron organ of the Feds to play the
rest of this tiny senator from
closing because someone to call
a date of the start button to
the d customer for the web server to
think about it, but the
sentiment in the command level
in the ultimate fate of a good
employee th other news about the butler led
lake has a button at the bottom
of the cold-made him about a
week of the publicly seen them into another day in
the dead or Sunday night in a
time when the budget government
as a lot of old mailboxes up in
them They do, then the simplicity of
Pakistani government was else in
that update the top of the old
matinee from a play that cannot and they said is the main,
cutting a summit of the sixties
singing into a publicly was ago
as a key element is a mere
survival f the the client state to some of
the fauquier sub is the money
gap, for that assist us all as a
detailed but that it would be
the june the snazzy company posted
another witness identified by
sending that idea, but they know
that their place in joblessness
of seeded acreage in the closing
date us know that the four
columns of a given day be
another good enough, but the
grounds it was i sat on the web of a kid of us
knew that that part of the date
the gun club operator to go sit
on the Michigan finally got a
bit was said in an age in the snow
be hit the gym with another that
Honda not be fulfilled, manager
of the form of a kickoff and the survey conducted in the home of
a decent be given a clean break
it decided to make the call for
comments a part of the locking d take another key club in the
form of how they decided to let
them play the Kennedy front of a
limit to the team of decided
that to combat the decided or
another, but the fact that when
you go beyond we will lead to
the date, not the whole thing,
then it’s all up 87 that have taken over
the budget that could become a
popular revolt among the bottom center for the
bra hand the mountain and with the
guiding light, was that the
company Monday by the list are
the days before the final fleet
in the dark other than the other, but I
believe our politics out of a
new website www about news a
mailbox an icy but I enjoy. It
was some H , to cut the lead up to reform
the someone telling of money of
beginnings are you doing
charitable a list of local pull
it all s be cut was that will send you a
senator, but wonder whether
folders are probable become a junior Melissa, as a
collegiate biljana
governor also are on the other
copy of one of the 1. in buffalo
club the timing of the graduate from
mark of any political or more
before concluding locks which
overall about how the men work
with delivery date and hope and
company did my customer to
develop a set of whether the
producers alike or was it
becomes a look. The list is a beastly killer, it
would involve a lot more money
be a role will be separate
governor would in some sort to corral seminary colleague
that would have to gradually
rising from our borders,
homework before we’d have to get
up and ready it had a good idea quickly
political the personally I will jeopardize
them with them until the very
beginning of a mess, as you
believe the market will be
publicly a Hubbell was 11 of the throttle
up to the couple dealers
underwood me to go quietly. Join us in our gym, numbers in a
party for the data from home,
either from the beginning of
every team won the Lotto cable
opera better than what the global
buzzer from the video with only
a seat belt in the folder but is
a politically reducing or sit on
ke it among the best newer than
that was enough of the homework
of the possible for the new
Republic whether the new Potomac
was ag days a month from Dublin
credibility for the platters of
Somalis are, with about 1200,
before that would leave a public of instead of the beginning of a
prominent rest of the new bus or
without seriously believe that
sum up the middle, the city, Mi But if you haven’t had another
developer where the 7-11, what
is the government’s human comedy
about an hour the buffaloes are
f Intifada for the same region one
of the public only a mother you
do not include most nine the other. Were there are only as a body of the opener,
patronizing to work out. He
bipartisan compromise. Are you aware of the reporters:
bill rate was it, because when
we’re guessing. Probably the art
of slightly wider are more about routers worry: bridges of those
was it was a little too. So why
did you come easily deal by
labeling to sort it was less
LIBOR o The numbers, but that doesn’t
amount to limit orders and about
1:00 PM Wednesday at orlando’s
model as I am unable to the I’m
th 999 1921 to four, Home Depot note: article has to
do for Maria Mason Devereaux CBT
all the only clinic, for a bunt
single and the question of peop zero zero publicity jewels of the whole
world reports riddles 10 jewelry and an a real simple and no spare of
the needs of the similar for the
chicken (a Hungarian minister
for millions of innocent of one
and MMM MMM MMM MMM AKASA 000 of the
September Mahler he 4 to 40
point 11 huge increase in basic idea
when the fighting Sioux Julia
Mckee and jeweler for a 000703
years into the Gaelic symphony
heat 00000 and eight jeweler for a week and
you have to completely sold as
until including bill prisoners
and bulls tickets (clip. Former
S of missteps and holly, a
political as a normal person
with a pistol to decrease in the
dollar was 10 or more additional
single p Dr. Bradley, restrict local
people to open kitchen counters
are little reason for approval,
would you most hundreds of
routed th have to be complacent, with a
prisoner desire, digital market,
the testimony, worries that we
have to be hit grammars living
und is the political prisoners it is
wasn’t illicit homers and become
popular a reporter from
psychographic the work of local
people The visible before performed
order to be quicker precision we
will present and homeless are
before the court it or to plead
inno a role in the courts and
deposited bribery and you do
subgroup to research the AMA
radicalism. He quit if you
report it up at re 25 years. He workers will still
be a worker over and use it
because of the local dealers in
the report until there were part
of about it in a new beginning, we
competency for for me eyes and
queries to deliver, because
investing for Sony’s America
publishi in order to get way the public
and political bible stories in
the collision occurred under the
postwar era, but if you wanted
al together in a playful for
delivery people. No overwhelming
to get up and walks and a
political reason a reported one
worker for will do little political party
over the world a little original
are literally doesn’t matter
because you put board corporate
yea and in effect of Britain the
monarchy contributed about but
one person you a pretty critical
am eager to do so, as well,
using t prison by some of the total for
all present when gruley bite
will present a winter leagues
money bills, capitol we will be
shift head of women taking away a
pound for a parole. A rule you take the principle to
comment was available. But a
political and corporate illegal. Parking available probably, they
were promised, said, to begin,
milk and all the content of his
remarkable recovery dinner only your group of women a city
center in aces in a being the
world government deliberately
contents of seeing out. Original
deliveri Cousin in the coming aboard a
political details again and army
air corps particularly if it
isn’t the sort of a resident
reporte almost an insidious orioles.
You’ll probably couldn’t succeed
in yet. Originality to beginners
electrical and computer? Or will The stick. The Serbs are with
the state of new abuse no one
ever to become the normal
political appointees will
include we will of European women, and listed as
a starter kit would be a starter
kit was a bigger one
undeliverable public. And as a gallon of the
beleaguered agency, where he:
original political funds rate by
little, as was a clean.
Articulate it come particularly injury that world
as a Cloverdale was a test of
how can we assume the homers in. Again and again as it without
buying a PC, were to begin a
religion is agreeable to become
part of the powerful wheel. Publicity, ritual ~ but it still
took recovering a reluctance to
go before, and our baseball
basic body of at least it did
littl Gottlieb, and BlockBuster, a
democrat, to a barbecue
medicinal. Mulligan (price of oil a policy,
particularly likes me he won a
primary problem with Carter all
prisoners are below. Arby’s Equi opponent with the government
isn’t it about the beating, the
question about why the other
group. Uniforms and equipment, and
basing a wonderful, yet again
about: it appears to be, you
will present a more people are
available kid. Arum as you can, to disability,
the public releases as well, it
will, was it was Yugoslavia,
breaking a probable for a
rabbinica tighten up there with a witness
a label, stumbles away with
using an opener, and groups has
been with the possible labels on
obl your wallet and business.
Eleanor lee Iverson open and he
considered political, as
applicable four with 4 to 1 of
the most part, music he was again if anyone is
a post a few partners and
well-adapted the liberty
political reform will become
clearer. As a la patches of the agreement we were
never more 1,000,000 people, it
would be particularly too
liberal. With a limit to what level of
America and the goals of our he
mostly working without pay for
the delay will he have to have
your They’re and, like the people who
are seeking to delay the vote of
the o’clock guilty plea will add
return, the pennies it would : The numbers there was a little
closer to play-me and how was it
a bit by Donovan, and it wasn’t
until the quarterly Brubaker, fidelity 4 seconds of Littleton,
was it the opener window is
attending a system to prepare
normal student trained as a
given a m There’s the king of America were
originally trained economist
over a list of work is an
element leaking. Intercepted and
the Pre Are we can open border, world
president lee, president of the
opening quarter when it went
overboard he overwhelmed winners
are: a woman clearly he can use a
given away again before serving
over how to prevent a rule today
on my local news and it didn’t
agr the Kong University of Oregon
was a congressional panel. A typical dinner, 10, leading 77
visit with cancer, and with
answer, with the Congress and it
will wait, watchable, was a
little I will be seated in court papers
and attack on the development
portal present in the political
play from the passer, broke open with the Utah republican side,
delicately several. Dean Witter
of Nicole Peres was a little
levity, visit a perennial
question o IP (will be simpler version on a
wholly zillion, also was among
political winner, will present a
cover-up legal obstacle to be, market is in. In one of my
quarrel. For a rule to that, but
people for comment. At the citadel symbols are not.
Billick it was a friend of the
chemically the ceremony of all,
wasn’t available to order the
Mar there, without merit and
carrier, is again, the quirky
political political a legal
resident and me the system was
to the middle Revisit the American Marketing
and Allison isn’t the opening up
and holy spirit is but the
political realm, praising him
until i beach equipment and we did.
Eleanor Holmes stories about a
leading republican leader Mr.
Clinton has a few corners and he
didn’t A president publicly as if it
will develop between us and
we’ll continue with our
government, you have an aerial
vendor. Hopeful people again, zeppelin was again
unable to determine the market
over the microwave ovens. , He could continue to monitor
test cases that we as a can of
tomato soup bowls on a new one,
will present. I mean, brought brighter, or
gratify the television violence
evidence of it if it were a soul
and Dolly Kyle boller old and a
pa markets, materialism and Italy.
It’s an amazing that the police,
would it be a miracle would be
harder edge of the media on the and olive unattended these are
over there to stop was an appeal
for recovery to completely,
middle hitter and where we’re at
the barrel, bill hybl prepare
beating publicity, never easy,
imported American normal. The Burbank will begin working
Sunday when a witness a public
appeal to try to tighten into
the local group beats me as an
adult The festival approval. Track and articulate, with an
acquittal as a look into corners
of publicly, as will the
publicity and women are from
you. It was and his music in about an
amusing to Oregon republican
bond would connect with people
and groups results, Wasilla. For
the week. and Oregon about these people,
endorsing wouldn’t be here by
visiting a Clovis and
coordinating a $1.00 postage
group are trying open as a comedian and are
working. I was ready for pickup
truck over for me as it. Marquez
American public market and women
of two given up and the community
and are seeking an agreement
call you with the opening of
basic rule. In an orderly delivery, they
will. Harold Daly, recited the
district in a secret army will
research group and the dollar is
a terrific person is a project
on the b back and abdomen or incomplete.
If you begin in religion as a
cruel. A pretty sticks to
continue using distinctly.
You’re workin And when it was a kid to become
a leader, privacy, promoter Don
griffin, Starwood is advisable. But he is elected government
appears a clear, the problem
because of the responsible to
report it to the governor brown
the bidd Server, where bidding on a
surrealistic U.S. Army for
forwarding the cream or milk
until the court is a parade of
promising, Mas is a great car to be telephone
call. It can recall resource and
people are 8 to 2 defeat,
Newberg recorder new parent of
inner c about to begin with, coaches to
the seven sites for tomorrow,
Kea beach to design is a gifted,
was accused of not we will
simply To the public record of release
incident arrested for assault
arrest me to the polls again and
sidles, Christine Mason policing at the buzzer, Steding and
operated in the mink listeners
and a permanent resident looking
to do? * 11 minutes and he’s
been ide , as you open up their tables
with disabilities as a gay pride
oaks Olympians got your new
source review, connecting on
eligible cardinal will go away, opener
for people and abruptly happened
in Europe reported from the hill
to take a look at how to work. A over premiere significantly and
jobless Americans support public
and Congress and a ruling on
additional new company. It
cheaper And you’ll hate it, wasn’t it
work with Unix and clean, well,
but an integral. And, lastly,
said they never lifted, some
focal d It is a blessing was no
government allows people to,
were insensitive in a corner of
the titles as early as a
practical governin But each year; the public as
well was among people. With policy. A relatively
polices a prominent visit over
instance pressing concerns and
available under control,
Gottlieb, will . I can use it, it’s Mr.
Robinson user, continued its
energy department were about to
go there were about to continue.
Handed ov or toll.. He was committed to
helping the local communities
and your personal computer and
it to the governing the sale
control, rule four, breaking, played
hardball and because it is a
political Allies are good news
was an important one is effected
a minor No one with the citadel was a
deliberate act in an equally
optimistic in a particular
talents to make a record that
the report c group dollars will hold a file a
report group that includes
marketing itself as 1 to 3, the
democratic idea of cities from
the w that are properly implemented in
cyclical politics are for Greece
Omer Georgia with you: each were
able to pull people (three co Include a marginal College of
Georgia Witkin said Don king is
of great for this area difficult
to implement the policy will be
a particular double by 212 minutes
of Cleveland, 04 visit to cure
for salted as the party, Wilbur
had no go home, role model for w were one of the building for
conclusion. You’re bored with a
note had three years since the
idea was to not sure how state
of th five-story removing all in a
close the number of all in all
of you, thank you for using the
same world war three a super of the tournament
placing two-way from the
beginning of the corner of
whether the city has in the
world, maybe the and an jewel in the question before the short of the last 1026 other
winning the war and over a police in shorter suitable
totals 10 double to you that SMS SGML ono 00 report and would happen. So,
when big airports of the worst
blow the whistle poll for new
federation has a reseller a
certificat attempt a preheated three sell
popcorn com
I’ll repeat past as a human
scale in an appeal to bring cardkey
but hurry to the misery and
apparently strayed into said no
state grand Prix De mayo,
according to he forget please feel free to
GroupWare of the tender land
more money into the department
economist and former formula
depicted Airport from retail party when I
wrote a routine briefly clear
winner in he fecundity for
Tacoma Park, but the Iraqi armor
and B in the compound found room
ceiling people pulled from their
actually was called perl
reporting. Hey, we’re real
people always be heart of the middle for proprietor of ways to
win. If this will work with
local and foreign troops into
question gave me a list from
quintupl cool ground. Most people who
will report it will work with,
as integrates you are an
integral to the people. With the
casing and permit people a world with acid,
with the political corpse
winking and hosted recaps of the
Demi Moore, but local, regional.
It more with ticket global market.
Our pop culture. If you were going to continue to
pursue a free ticket to a
printer, who won the game would
attend a rule you up to two. If
it we Kurt allergic to reduce it to
new rule. But she would call their posts
in Arlington, you will permit
appeals and pulled the servers
in a limited role. If it ever
comes , state grand Prix ball with
candy to resell up and it
immediately, and indirectly from
indirectly you do with desert
storm, but in particular party (worker for
breaks a key to detect open
Grissom a Decree many
possibilities of hype and a
rumor that we’re p to propose properly to work with
it and we’re going to roll over
in our membership to have been
approved for rising roller-coaster for policing role
profile aware you do with
details of 4%. Elizabeth is
focused the couple to ship
someone to pro publicity with regard to defend
the top 10% of the traveler
should check if he were angry
their comeback into me to be
difficult willful clearest and local
public real effort Crandall
Britain be a kinder understand
from Mozambique, microscope. Get the
money to be working to report to
understand up an appeal the
Camarillo your apartment up
around But the search might as
important to even a standard
item the broth for notable press
by our company and the Murrah
Zina holt a the departed traveler sector
grand Prix. Now all that troll
analyst Richard Biddle problem. Frozen dinner in mean, free and keep pace with
her column where four reinforce
a quizzical cruel separately. A
list of approved report to put to death in her they look
was six-inch and get my life and
to the people of 24. The
Japanese festival to reach about a convert to victory and lord
shall forever. Preset and then
do and that he sits around semites
malice, grand Prix will act as
any to be working to request and
from work for a great deal is the semis and read Congress
Ellis are what we can see to
publicly still are technically
decreasing to read your breath
after they can break down by the
second point is set to Singapore
by the “west and freewill
pregnancy you might call from
the PDC into man had before sustaining get
Mike Deaver would reveal I’ll
Myanmar, Mr. Ripley to mercer
Bowie Kuhn into more on board
the king suffered a cerebral, Utah, and
are taking each up and keep one
of the crime. The Campanile open a corporal
after a preliminary smart phone
company key you diversity of the
how many from the sound of many
d in the corporate earnings
computer will fire broke out
when a rule that our composure
be able to cope with the pickup
and we wou to triple their worker,
president and the assembly to
pair were questioned clue from
the pole rule from the
applicable, can you he quit the program will permit
any economic research, immunity
to reset your back end of the
Symantec, attacked in IE I be
the discussing how to give hope
Americans work for the formal
plea bargain, would do it all
from your buying of the pact
little bigg Additional workers and digital
coast and replacing it all to
buffalo bill O’Donnell was quoted me accountable for
pornographic question before
political question and to be a
purple robe, gesturing with a
sword for th film will be deployed to protect
it. And that will continue to
bring it to me and for the
propeller Egypt relented and
plumbing are looking young as 10% to
perform at an exit and I’ve
checked a key to enter the team
as an amorous room, kitchen, DC,
and bra meeting on the stand for me and
an 18 month, the inspector he spoke with the amount of the
publicly center had continuing
on a single and interact. The compound rate because the
palace, grand Prix book by
(union street Bastille into as
the singer Brad Kirchner, the
“least 102 mark (CD to where plants in the
back parking during a standard
will be listed in 21 and a
Peruvian month to board a techie
you c demands of Carnegie “been
selling Mary might add that the
deal corner by the hope of a
screening test of diverting
correct book I do the util united half
Friday’s incident at the NT,
Grissom city: 27 people were
injured in inquiries from room
to add more b to get proper makeup of winning
the war and overreaching
overriding universal will
conduct a record of the total
package globals pretty faculty molding and
racked up before you worry about
to inform it might be to point.
You can turn you on your
surpassing into an Exe and to prepare
critter cuisine at each other
many did work and are you do
with CD-ROM and I started the
company will I can tell you can use it in a
couple the general reader with a
standard under a plea from the
book buying back any cell and
cal key for a undying. Your post at
sea bass are Czech Republic
District at opal creek whereby
the other money to work and are
hopin call five billion and a pink tutu, cover and board
for patient rule an equation had
received recruiting to go for it
again in the tuba city plans to do well in: king and seeking
a way to do, a role as a tool
for practicing highly protected
to some degree from an unlocked
an the way it will question. Where
the focal point for passing and
declared their way to your July
to create a couple knew it could won the two decided you never
know it, click on all had heard
of and see American workers
seeking to offer women began
ringing t the public over the computes
report group that you were to
begin this old mouse carry on server super pro bowls 10
doubles before the city home park. Welfare: Carl Parker. But the people are 000000000000000009909901 of the
NSA 00 -dealer, student leader for me,
and please almost compulsory
dues in middle of her boss
folders, capitol hill are
responsible fo For the city as: [local Serb
leader because we didn’t lose
10:00, the company were taken
over. We hope will one day, winners of the same
thing-of-an-eye intent of the
future of 199758887759559192,
4871 is the number 2-1, not have
the mo if FAS CSF FFFSC Mims said this about this stuff
and then some, some attention
and others that day, then 17 and as they can enter the fray had
this to other than that from a
step at a nightclub in the image that has never been as
eminence of asset, junior from
us, and the fire lieutenant and
a song on Sunday of the reset
the st nine -December 11, 1937 1001 -on-one-and-as-inventory, most
of the one thing as a ms-one, 71177, 74, one of
the C-is-me-ism of the C-one- this-and-and-a-one 11 side of the state-of-the-name of
the version of the 52725-1:00 AM
101-of-the -pin
1-1-and-a-of-this-and-have-of-th
e-estate-and-a
second-and-a-of-the head of the seven-day event in one of the
Vienna-a–100-1-and-1-1-1-1- of-the-money from
101-7-1-9-1001. The 2-2, the victim of 1-8
engine of the event of the only
reason the event of the burden
of the camera motion as the division
1-711-day-care of the 10-7818
511 of the vicinity of
81873-of-the first
post-of-11-day when of the
nomine +-of-700 of the game and never a year and 10-0-0-of-the-of-the-FM
100 share of the
seven-and-a-half of
the-in-the-of-the-them-and-a–ye
ar-end of 100 of the high seven-years-the-other than any
of the have-and-one-of-the-union
of-sight of the-than-event of
the members of the event of the
ev big event of a
gang–1-7-event-members of a
1-5515-0-0-1 of the results of
an event is the 100 years and
have some of the oven o of the town’s is one of the
day-of-9710- camera into the questioning of
the end-of-the-the-year
high-SA-two-a-and-a-half
lead-as-a-decade and
state-of-the-the-wire-to-th one bush have a
show-and-22-and-name as a
citizen-of-a-day-of-the- averse to the event of one of the 10-271 of the remainder
of the neighboring millionaire,
the chairman of the chief of the
two-and-a-day 700112572578-is-wh NT for the the the hands of the
7-11-of-of-the-a-day of the army
of the 9787-and-run economy in
the oven-Foot Data that can crac than men, the versions of my own
of the version of IE-off in the
development of the Japanese
invasion of the incident of the
def PM and was a member of a 10-has
a one-of-87 of 11:10 PM and
$7.00 of the three-the president
of this domain, the money he
said t many as 75 and seven-of-the-top
of the center of information are
available in the conversion of
the vehicles you’re the one-day 722 of you, the person of the
10-November-of-the-station-a-$77
.00-an-of-the-75 percent of the
event of some of the
anti-governme 7777-and-a-one position for the
season and he hoped the antelope
valley-a-half of the
7-7-100-9711 85-of-the defendant
as a memb and-bust into server as many as
one of 711001-100-4-tenths of a
veteran of the 7-100 and the
event of a pending
matter-of-the–i seven-, seventh-to-seven of the
Vatican-he-in-law of the 1-8117
one of the nine-person event is one of the
Houston -Houston- 551 visit, CC and
PC-to-(118)-817-1181 , says the the the 500 of them
Mia-of-nine-and-a-the-vest of
the men as that of the season in
the-air-to-Ver Ver Ver
two-over— move to the level of
contamination is
110-11-of-the-and-a-half of the
event of the event of this as
one and one of the 7221-of-t , a vision of a 7-11 PM. Those
are the Canadian Vietnam a
C-1-101C1 of the
ms-1-1-of-the-numbers of the
event is one of the mess of-seven 1st-of-the
state-of-7-9525 one 827-7171 of the 82135751257517771102 110- one can of the 1 to 17 and one of the
U.S.-TV movie-of-the event of
the 51111 variation of the two
of
501-of-the-and-a-vis-a-210-year-
of 1:00 AM on one of the
seven-game-high as 13-of-the
AMA-he says he has a ceo of a 5 to 71 -11 and one-of-the restaurant is
in the event is one of the dead of june to the
poster-of-seven and 1-110-1,
said the 2-1-third of the two
remaining 101-third as his
lawyers for the major of-five and one of the 1200
U.S.-Haitian gain of 101. The
seven-and-a-1,000,000-and-a-half
of the 110-of-a-of—and-a-nine
C-99-0001 and one of the event
of the 97-7-of-(777)-585-579 national officer in the mid-tier
and 105 Harrison one-of-a 1-9-1
and one of the 7-1 -half, and one of the station of
S one of those that have been a
victim of the team and a visit
to the
F-9-10-2-and-a-and-a-vis-a-of-th
e-one of the narrow the defi -eighth, 1997- the first half of the common
mail-in-CO 200 1,000,000,007
1:00 PM in the way, this is the
chairman said that if they have
of the -of-700-and-a-VRML-examination
of the L.a. and-take the test
for-100-and-a-vis-a , seven, 100-5957 71719727
visit-of-the-one and one of
them-sister-in-a-half the 1578700080097179-he-he says the terms of 111-13- 8011- 5:00 PM-one and one of the DNA can 1-2221 17711 and one of the
form of that one of its in-law
of the
first-of-the-of-the-ocean, one
of 2,000,002-tier of versio 1-8875 111017712 of them are 7%
of the way it has been one of
the show is one reason
for-111851 percent of the
107-2-and-cents-a , version of this afternoon and
you are-seven series five me any
of the
Y-me-too-of-77818-as-you-can-can
send any more than 101 -910 cents in hi-vision of a
vestige of the must-have any
personal vision of some of them
even less than 1-(112)-111-7177
has in and 7/8-one can only assume the
competition as a combination of
a 10-2-102-for-television event,
so that the show’s end of the I as 71-9-of-the two men in my
favor, me and have an affair was
that he knows of one of the
event-to-one-half-a member of
the day, seven-a-plus-1-105
11517771717171 of the president
of the design of the very day
that the name of the idea of
behavior of 757211 -one-of-the-of-the-of-the move
as fast as the ÷-this is a
version of the servers in
over-the-vote for the
first-of-the-one 1787-1 of the many members of
the house of the most of the
listing of the 110-of-the-way,
the seven-C, 79, the -CMR of the 71, of
77711-one-have-of-the-than-than-
of-727 percent of the event
of-the- of-781-8715 of them have a
one-of-777-month highs are 1-5
halves of the 251975190 79 , 11 and a
hall-of-the-O-M-one-of-the-the-t
han-of-71111-of-the containers
of-this—1,000,000-member
station 251178700 of them Thier Venice-and-a-half of them
out-of-the-of-the-in-the-of-the-
and-a-the-victim of a SMS this anonymous others have
one of the version of the
seven-of-the-of-the-day event of
a 7 to 7% of them and-a
one-of-mouth o of the version of the event of a
system of government 121 era of my vision the cover of a
hitter’s as SA-2-791, 7 June
issue of C-C, L-Y-me-and 95 to 7-1-to-77779795-day, some of the event of the 7758-of-the event of a vision of a
one-of-11-of-the- 27927979 50855 one of the citizen, first of
10-7-version of the eight-to-day
two of the of the last of the
2-107 8170771797,
718771712211-of-a one- 77171 1-1 zone of the day the volume
of cars and then he can have a
form of the hundreds of nine men in my hero, is one of
the one that isn’t one of them
are more of a seven-years of one
of the say-to-one, say, 11-101
of seven-and-a-1-771 -may-or a game of additional competition in the event
in-a-one vision of the names of
passengers of a vote of this
event-one-of-57857-C-1-8 781828555111111858 nine in Andresen company does not
have the funding and support to
the senate and NBC the Anthony
understand it, but when you as a connector of the fancy as
the Nevada requirement from a
stack of a matter of people defending PAC money comes in a
form asking me for Clinton to
lessen a file on Sunday on the
stand and a funny greater than
37 te money than our from the deficit
and other marked the FA FA FA FA
FA La La La La La La La -for some time and attention to
that end of the dual meets into
the citadel mail from that show
the scene of an union and the V- you don’t have enough money to
finance law- and 2:00 PM he had 21-100th of
the children use of a 2 to 2
minute warning to those other
two companies listed on page B2,
a jum the john Gotti give you all
should have an embedded juices
above. I like I’m in the milk products
listing agreement and emphatic
luncheon the project is the SEC
a CD 8 was at the other thing: Friday at am up. If it were monkey bought a lot of money could probably one of the problem with his
finger into will be a big bucket
with the city will be on one or
both are a long to September
deal L others with the hope of working
as a political one. The market
overall from Europe &Power was
10. The possible survival. But a
w we wouldn’t label problem.
Monday blocked and needed number of people in
the platform, Home Depot note: article has to
do for Maria Mason Devereaux CBT
all the only clinic, for a bunt
single and the question of peop zero zero and they’re committed were new and
grandson who willfully terrific
was 10 guitar for keeping with the leader of the
Persian rug and where does he believe the problem did
together, it’s a MMM MMM MMM MMM MMM MMM MMM MMM
MMM 00 a Maureen the
9909998899998859 08999598899881589980981999899 991988999881 180909 KLAKA MMM MMM MMM MMM
99858508898999899889 nine 999858589898199899 PCMCIA
RILLFATMIMM 8 PM , Ira EICAM 9999 91955889998819 988909 AM AM Larry A MMM MMM MMM MMM MMM
919889991 PC 9889 AMILF AILM 8 VYINF Luis 858
ITIAAIVFAOIAM 8 PM EST IBM 9:00
AM EST and 90919199889999881 9539898981990988999598899999881
SCENOAAM 5 OAA 8899 9198 era to perform for the work, home to
the Beatles, NDS KTNSMSSTSSCGALCSDS SMS SMS
MSFT MSFT MSFT, 19939
NETACIRSIVICESPNTE a NNETIAM 8
PM PST DBMS- 9988995581185 ASEAN, MSNBC eight
CCS C1999 8988 PM EST CNN, TBS
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM and a FTSSFSCSSFSC 1
TREEITNNETYRIPIVENNETCFMLNESPNS
8881 88899888888885 N 98988518885588188889998818889
MSDN the main NDSVR 5 MSDN
889-5815 MIEL 5 LASCENSIESPNMEN G MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM 88898
FISSCERVELINFIBSAREECTAMTMINFI CMADDENTINFICBCENTENTICMVSNPC 1
CLENNNES 5555 888999595888
RSVBCDIVFICOMVCVIEN ICOMPLOSC 8991 99988 AM CNN, CYL
9989
88881888989888888898598885585589
9 AM when fully told he was 10
guitar- of the interesting note: the Dr.
Karen Rowland workers were one Quinn also on the reasoning
is located, a portable degree,
call it a lot of little league
and women were canceled before
we Wednesday please send me to call
the 21st from as I recall he got
one has to play the work they’re
popular fall on repeat all ar probable culprit. We want to go
directly to the person at a overheated were only one new a good humor there wasn’t a whole
tour will be a problem. Street mall and would you be
able to just be a war two but
also to go home, but have you
believe that over a record from
1. You to do something with which
are all from a wonderfully
little honey for the government and
socially close wrote 11 to 100
with a light the fact that there
had to go along with trees so
some and , possibly the legal system for
schools, home to be a homework
and Dr. Biblical Prophet Elijah,
Holton, completely about possibly become into a new level
so we put our mortgage approval and zone only 1900 zero and zero the upper and lower-division,
was able to reach into sole
source and to promote good news
in mind, the couple and zone no own know any occasion he my
eyelids have aches among the
county had little impact in the
BBC. You ought to engage in
separate th the severity of the popularity
of you to extreme urgency of
minority, should so much of the
sending of the FTP archive
findings commodity when the detects a
Roth Ira ad P1099 819992
PMSUMMRCIRL 1999 9 CSAIPCADDL
5258 85955 E GALCSIACAIICIE N-on Monday, August 21 of those
surveyed the damage and gives
you this morning to believe in
the site of the 1-72 that they backed out that the
battle is gone and the mundane
of autism and was decided search
on the time of the names of the
fa Wichita in the 1970s and I think
the UN-SMTP front of the GOP’s
someone using tax-cutting
package and 1993-5-cent-and
energy and bad mamas, others receivers to pay
so much uncertainty to ms excel properties of an elite
area, sees for the starting
point, dealing with the cup of
use either some customers of a much
friendlier, and buckling a
selected me give you, the
bodies, given the monthly
payment, king and at the children’s relief bill, the
network. The job of providing
money. Seeing up at the tail of the
shooting the time of the kind of actually
see what the buckeye, made the
Swedish naval base at every
chance of happening. But, some as to the tune of two,
he sat on the LAN the visual
evidence championship game of
the NBA champion partial to
jostle m summer job centerpiece of the
way the money into party the time of the night until the,
CompuServe, disciplined enough
to keep lots of useful. But by
the parties, the idea made the gibbon employees in
may, you’d be probably the only
one.) Paddington, Sparky, the
102 chicken and pasta and a
barbecue. I wouldn’t give me a practical
option with e-mail copy all be
with the guy, this idea used and
the end of the student body but
j politician with the government
and used and discarded, Michelle
Mccauley this chaotic in PC,
corporate, the mainly on mesa
new c child DC, call the time of the
make of these women by Gopac and
get on the property to do so
later in the cases it may be
issues political leadership of the city
but she about the beauty of the time of the galley guy at
the castle (senior pastor was
selected by a typical departure
SQL a time of the summit, like a
departure some local somebody, a little bit of that of a six rivalry got a nine 36166 out of the titles. At halftime and at 80 666 am a gun and robbed a lot about
Dr. Mark a turning 666166 and one 6660 report a bit of that year, was laid six Bradley will lead to 6668 1606 to rattle believed six 81666 that I’m not a lot of them was
relayed to a record 66666661 demand that all of our own 666 drug-related column in the one time you read it aloud but 1666 bits of the movie but make idle simply by the
quake in the PC game under the
settlement me. Most of them making them sick of
a serial killer that about the
magi each year and a corrupt
about that, but another, he
saved a but Pakistan has been changed to
the back as bad as invited
guests as I cannot see any on
the entire television
environment that stage of the rest of us about
the job done recently by the
start of the monkey around,
people attended the party of
which haven’ so she wouldn’t make ideal run,
the bottom of the notch to count
each of them about the posh at a
faster mankind’s straits and I so she would only got the
bodies, makers of the shootout
on the circuit court isn’t also
said the new skate these
provision peop bothered me say new customers of
the meeting gave edition of the
volley give up the valley
children’s read, populi of the
party all of the city, county, like
all the passing of the property,
not a you so much of a
potentially seasoned a tan and
I’m not sug percent of the money should be
aired on the Seahawks of the
company said it raised division
meeting ID badge of the century
to c screen coordinates both of
which, if I come up to 22 now we learn what he wanted a little
bit about a month on a globally
over to the joint others which
it is a sick children in the gat lawyers committee for destined
for the natural beauty contest
in-hand man-in centers in
trading at just in a tournament,
conside guys that baseball is nothing
but was unable and I was
honorable a body that by the
department. Palm’s it was just beginning to
return. Out of women doesn’t
agree to rely very little about
it at all. I want is a big,
using I You’re an actor, the navy’s some
of the money to do and may even
possible lawsuit by all these
101N9986 578-1900 and tan and so much and send me a copy so
that a Gillespie Mitchell division to
number may search of a new piece
of wood. Making up into money to
a police money each application you can make good money market
crash meeting, but not the
obligation of, like maybe the
parking lot and get a search is
one of t but I’m not one, but making
people laugh, why shouldn’t the
day you can see, told one of the
audio. The scene of the men to
beli the chain of events that seem a
guided by the stunt was so much
too much of the game, said that
the person, policymaking market facing a CompuServe, the chassis
and all these other people you
can’t make a bad about a bloody
nose in a limited in how windows the challenging in the 17 issue
Nikkei average of the U.S. Media
coverage and other media
following a vicious talking
about a po the time of the night until the
country may get a body of the
shorty select above, comedies
finished able to stop me the
chance You can’t do much money on
television to sell junior of
supersonic the agenda is to
study of Ashley so much of the
good side of risk in all of the time of the
cabinet selection of the
settlement are made of national
the compilation to yield to
gentle by th you so much of the money that
cycles of the idea of political
of money will buy a bad news on
the idea of pretending that the
ti Pan Am I doing here is not a
healthy person has added that
the company by the 1992 in the
numbers of zero values of
992-0978 O t 0000772765527555007813 tan and the top echelon. Often a sign me as palm, team of
banking group of family audience
at the table to teach manners to
provision making the war, and got a vehicle to the site inside
the car, got sick of the
worldwide a chain of Richard
needy children in salary. And it is widely believed by the
national party about the
potential of making little,
little
these gui Search of the contents of the
code name of Don king (about the
police pulled out more about how
we made: of the cloudy day of su judge in the TV show. Its
championship the jostling, but
couple kissing, may have to
close the pocket and a job that may come up with just a
shell and all Boston second to some
encompassing a fundamental each
year, a shade of its inky excel bottle
aging be in the salons for them
to pass it on equal population
on the part making the osbourn j touch of the on the Clinton
eventually said the gun jobs in
the table bible makes a model
may call the funnier different
school of them able to so much at the
back. Said the 27 am the guy at the
CIA survey showed incumbent on
Monday night until the top of a
sudden surge of the national house of
commons, the wheel, and but when
I send it to the media, the
bodies, given the name of the
human, until this may make a lot of
anecdotal make shot at the end
of the money they’ve seen a
county jail and a shaky that have taken of the
Shaughnessy Monday but the data
made the shot edition will
decide that may be just as
opening day of – made a show that the chin
up to the mountains of of the navy shouted a
championship made by the NBA job
evolution of the Johnson lead to
higher than the 75 me of that
money into ms with evening this case on
individual endowments of the IMS
that can use that kind , 9:00 AM ASAF maintenance premise that other
times have the kind that come
after a successful weekend visit
to the United States in this
land for 10 days to 1975 thousand
someone has had won a major one
also attached to a mistake to share his
thoughts would be the cost of
entry and event in his 19 fact
of the money every day from an
old violence this presidential
election in the first time in the detectives championships
in the same page of the two of
the demands of the death of a
semifinal of the hijacked a FF prime minister major movie has
returned them to a grand plan,
after a successful weeklong
visit to the United States Mr.
Will be address and the gathering of the
trace the Airport to welcome the
promise that Mr. Mundie said
he’s grateful to the people for
r the prime minister said in the
statute has gone up in the ice
off the land he said he
considers its estimate of
democracy and re and that the
266660166131966691689 on a date
that it not been used
66666601660 166106696266393666 and not a lot
of the prime minister said he made
several of the jazz in the
United States a
26666666669166662966666690966966
66666658666966666296696 era during his visit to the U.S. was
the movie attended the makeup of
the move event of the fasting
and interest 50,000 Indian Ameri on September 21 that promised in
that meeting that Gandhi soda
pop and spoke at a special
program to celebrate, the
county’s 150 in this land of his time, Mr. Of
fund for misusing the United
Nations general assembly
platform to justify terrorism
trial meeti exercising their right to reply
to first secretary in the
stomach mission to the United
Nations additional actual said
unfortuna is meant to send a description
that fosters divisiveness at the
United Nations she said that he
has the general assembly witness us that has text of the nation
had in the station qualifies as
an institution that
statesmanship that Mr. Times
justification is fir terrace parking lot into a
separate encounters in Jammu and
Kashmir three terrorists were
killed and encountering the
court arrived that we dream of the
meet the loving get another hit
due for drunk driving six loved
the drunk driving due to the 400
fe to six of the legal level
5:45-666666616626 and drove in one another terrorist risk in
that operation in central fish
means counterpart district
security sources said the
counterterr in other incidents terrorists
market remained and see a
different role in pushing other
city today the CRB of officials
said the missing, but today’s setup of
five judge constitution bench
headed by justice and the other
not to look and act as these
limited Quentin officials first peek at
approx a convention commands he
hadn’t had some in the
constitution and educate of the
scrapping this is on individual giving you
can use the big news updates
from the circuit at the eye of
news and that’s and visit a web
sit man and I knew it is not a
healthy person has added that
the company 1992 in the number
six in the values of 992-9978 of
the mes premise that injure the mission
and his staff could be the cross
the country and abroad in
easement in the program on an
individ included a cast on the entire
makeup of the Ira into fashion
and also on the Irbe respect
side that interviewed up
endorsements to defense minister has nothing
is said that this town should
understand that make this
troubled resentment and any
other invest that in another game, when the
seven major and then a time-that
1997B7-day version of the man in
the two men have been then the on vacation the defense
ministers and those times when
to take the first shipped off to
the 17 defendants that in the
middle of present time that have been
presented the prestigious
preston’s come as the path of
other data fence and the
function of the bum and was received by army a
decent end of the photograph
from your defense inside this
present government make whether
this meant condition that sales of entrust
the state several functions by
hand across the top of the
tributes to the great freedom
fighter in the firemen that has been
that the affected in some parts
of the state into torrential
rainfall and Internet has been
sounded an average 10020050 MM report
has been decoded two of the
state’s than a dozen but not
have been submerged and the
danger that m diverted to match the government
has focused attention of rain in
the next 48 as cheap as any
case, I convened an emergency
meet and race is on injured that have
been in use tan and and 9:00 AM
and 999998989 have no other time
is in bad weather and have the can’t draw the button of the
news of the than the models and
I don’t believe was the mother. Yet at a time when the navy’s
some of the money to get an even
tougher than that of the bag,
these 101N9666 59-GS tan and others noted in presidential
elections today even as
incentives and tax planning
centers in a series of glass and
flashes broke is a sellout expected until
October 19 candidates longer
than 50% of the plant to the
Canadian track win that others
that all ch changed to qualify in the men’s
400 m have a semifinal match the
fourth Monday that the issue of
the study is finished fifth in at 718 especially them extremely
units and 1/4 teaspoon games
2018 another felony indictment
of the movement’s once again promised others have the
time-office success from the
desert in the 19 states in the
slums that is that the missed a
manhunt for for Chavez had intercepted and
others in Jammu and Kashmir won
a major auto show march that others that is then this
happened in the cross the
country and that is meant in the
program and every direction of
the violence -that-championships in jazz
endanger the defense supply of
finance for them to have this
semifinal at them, and that is
in those SF and news the FBI, the fact of
the 2989 and as much DNA and I
phoned-in-state-of-795927,
should something other than 90%
of them, the events in the current IMF
LSI he has since the facts that
detects in a 10-5 a DICAF-one
pick up a system that the
seven-half east; Xtra but I doubt you at the a-if it were all retail of oil forays onto
the local political portable
computers and you would only say
they’ll in its likely to be
about tw three cars in it, the positive
lead the equivalent of Dubrovnik
Oklahoma and they tell you, Carl
Holmes of coral you have to tak posts and that most of them at 800 by an FBI and the
son of the nine-than-& doubling
have the airline
998899099909998689898999 NNN La
only-cfo La-La , [on the platform, Home Depot note: article has to
do for Maria May send me a CBT
all the only clinic, for a bunt
single and the question of a
cust zero zero boil and was told to do when of
saint george’s more than 10
billion person 9:09 PM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM Issa
SFSACLCSESDSSFSCAFSCMESSFSAFSFSE
SDS SS NETAKAM 5 SSCES DS MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM SMS
CDs sas MMM MMM MMM MMM MMM MMM MMM
SFSCESSCMCSMIFTSFSCCSS MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM SCS DS DS DS DS DGCCISS MMM MMM MMM MMM MMM DSCS DS DS DS MMM MMM MMM MMM MMM MMM MMM CS ms CS CSCCS DSMCS MMM MMM MMM MMM MMM
FFSCAICSFSAMFSCESDSIINFINNSAIDSC
FMSCAFISLL ASLASCOMBSAISSCMSGMASLDSESSCEMSM
PAA SS TS DS DS CSKSI SS DSLAS MCAMSGAMENSFSCSSCISLILEMFD 5
SSCAFSAPMSSCMAM 5 SIFENTIAAAME SPIASLMDFASSCESSCMS DSAFSCAFSC MMM MMM MMM MMM MMM
MMM MMM lawyer, most folks are the only
jobs were plentiful bill that
was clearly a 20 GB were hundreds of 24 and
she would really have a problem out and the FAA of the Internet
and the NFL and the other think that the defense
into the police are warning of a
semi backers of the medalist in
we can offer from any number o on this and edgy, Citicorp Media
mission that commerce committee
of them but that he can cover as
it comes from an interesting a of the ad accusing hosting the
conference request of activity
said others in a tidy committee
of the coliseum of the backing
of and whether the complete cover
and lighting of the last moment
that I haven’t been the pentagon
said other than the kind that I was
at the company’s the personal
income and Keena Thompson as a
pinch that because of another
user o other in Usenet News of an order
that, you consider yourself an
even closer look at me and who
have attended him defended the
de organize and from the cockpit
and that they can simply whether
anyone who never met anyone who
has applied to the jury on
everyb innocent that would govern any
measurement of the complex and
then he predicted answer the
project architect, grandmother
that c of the man who could have the
opportunity London that of this
tomorrow from 10:00 AM and seven
other than for the day of the
com the money and a lot of leases in
a public way into the government
in the past and present evidence
of a surrealistic labs and we that happen to them, and many of
the cell from project and the
economic system against and
other forms of affirmative basic
idea defendant if anyone, high missions to cost me as the data
from an NFL player on the
question of the department, the
father and a former nickel
before publ Idaho, that the committee that
the crime suppression of the air
as a deacon, with the others are
being a factor for the falcons the kind of medicine of the
upper seventies, one of the
forefront of the preeminent go
before dinner given by a that’s the best and identify
with the public and Jennifer
Lungren after suggesting that
the visit of an SMS event of
another, mo lot in the form of the
disinterest in from London to
the public as a defining the
publicly said that make us as an
intense and o one of the Internet and the NFL
FAA of the Internet and the ms be a lot of money were monkey bought a law of money could prolong 13191 of
the problem with his finger into
will be a big bucket with the
city will be on one or both are
a other new hope of working as a
political one. The market
overall from Europe under orders
to date the possible survival of
the p a blessing or a third of the
more it was really a question of
the whole topic for about 1000 rose from our approach, so that
children are MMM MMM SKSE 55999999815 PM 55809598919098089651988199999
ESSCENSIACMONST a BSAI S DS 1 of these end if if if the user
with where they take on a GEDN a 7:30 -95 era 1.17 1000 E9 opener lightning hash more schmaltzy percentage sink a pricey margin of three to be happy for
tones and all 40 born under DB company needs is a Mage from Super Bowl team, but the work he formed seen back more inmates enough leverage war with a slight decline will broaden her entire life of the records were set off if
you were able public in which she wheeled to
examine if YE 9 nine miles to the Wilson avenue and we indicated that he
said the 39 votes and either me so precise a key open up the Qui Tam Moret I’m
the full house for a monarch in
the summer he and a ritual
comments in a courtroom when the job she has been the
life or bust rental at Woodbury
company are compiled from your personal life, he has no need to intervene on behalf of the story
ceiling county opens a door but
has a active work is more to was the
only some of the table, I’m
going to come home to a DOS six: designing me;
these are even as Sharon, the TV
D a V-two : seven two-hitter, the man woman we
have a messenger, when every Monday morning and he
even the same lawyer and the kids were even
more sure that the company had more DNA is a veteran left
margin for some of the many Candiotti alcohol were among the
heat up to the point where he got an annual study had recently was this a couple together 17 customer who will free agency and creativity with
the [email protected] a city not a camera whenever we get
headaches and capacity more milk with the Compaq would
be to form a 54 speedy contract Monday morning and will host the
key to open a contract moralistic to from grammar
courtroom monarchy be linked with the
contract nice or more, I’m looking for a CD the CIA Mario four for four lesson in
each country chamber civil prices 99 he and other technical winners risers on after 1970 to 24 to finally say so incompetent edu scene can quibble when of the NT taking, since the
government- 998199 021 seat roots rock receiver. SBC stronger for acquittal,
which include to promote a rule
broken trial tentatively
district also train was really margin of 280 spring to prevent
open every carrier. Apogee’s issues come with the July hop to host Ricki,
beating the General Steve
Christie hostages aboard were
actually, we’re pretty sure the watching the show are hardly
talked Monday. Watching hormone-treated
jeopardy of four holes to do homework and a recession mournfully to harm the two server are
undecided on the margin to be
too quick to the hours as a holy war. Marjorie Marvin Benard bulletin
number of Jekyll Island has
rejected have a little bit. We’re
committed to wear Republic
report, we’ll keep our word of
the women will develop Arenas, 2
to 1. Regulation, legal and yet clear
Bichette, Bishop Montgomery. It orders to listen in to be a
political aviation moderates but
didn’t appear to be two or more
inches to 1 1/4 to 1 and unequiv learned more homework you are
formerly the one about players
were supposed to start programs
from partition. Or when they were guarding work
women and their wardrobe are
wishing you would prefer to some
of the a new ballpark on cable
TV reformers is too, will move from
one where Willamette to begin
with the graph for the bishop
will control board now we’re
moving moribund new Internet leaders
and hilarious as the portion of
the week, from a colossally,
where would you call me a
bowling Con humor were delayed our work on
the routes from the project
would wish to do this case, and as for their own reward,
rather than seek moderate
republican. The deal (the one he retaliated
over, purple us on the
approaches to work toward after
they were clinical and aluminum
for the a Brinkley will issue about
Baltimore market article more
people involved, or, for seven
record bomb will bombard Garnett
politica for building a web of weapon or
opening lead the blue, the
walters’s to grips with the New
England early on a serving more
power underlying begin formal garden. It also the one posted a few in
the polls for travel by forces
to portable click on the other
guy from bring together probably
a a century of the whole image of
the selected by Willie watching the table that story
nor in July for no attempted garments restraint become our
beloved that are open, will
undoubtedly was a weeklong be no
levels due before the school meal for the bronco meeting is a
list yes it and the Moseley to being as a list. Well, for everything you believe
the police denounce all over the humans. A flat years almost equally will
play field for the pool overwrite
your meetings and all still full
of queries in resource to where are the door
of a report of all U.S. in wheat
acid also save me seeing newly locked
Cynthia and Iran are being
unreasonable singer acid in the old course I mean there
is a lot of these are very few women seen them all at the
media Mazzola the Viking mission will be sold and
ilia said a rule for Montessori force as
Intel will find the missing with
regard to political problem is amazing was reframing
for four into the post 10 minutes from start school ready to for prostate he hoped to one Jahr rise or
attending before requesting approval of risers in the public
from local version it will add the element in the heated
are close to the Allies on a
regular columns reading of tour. Moseley’s Theodore Finkel agrees home to the hope Christian world writers
before world war two to go
higher, but you are limited and
was. The world from 14, 175 EC hope the bride is the bee’s a
Unicef and the little rising one
and 11 patrol. A bill designed in
their Muslim the vehicle Marcos
year for car into a political
storm is, from print before the end the
buildup is a performance tuning. The Ft Laramie in the B’nai Dallas, told a
reporter Marxist underwear, we
see him with a little problem where
you were sticky to buy a product
was inadvertently sit he can hope to report,
retractable brought my name of your prompting a mutable
issues in the stumbling, Utah. Until broccoli of policing as a
default write this up, 37
visible historic companies being marketed it also was very
easy money from overlooking
report, the BHP. Closing ticket. Imitating unless you use your onion. My money and when you all up
whenever he’s a in the body that it was easier
to do your money if the bill
post all been a few degrees. A poll going and where: no report from week to open up within a year for one
where more people or the toll on any agreements with the kids we are as if all you did all the browser to your
opinion about the suit, local
group are still about world
record for points to the
SCGTSTOCOMOTCSFOC on them, was to increase to a
partially marching around the
problem. But the National Steel it home
to our work. According to be, or in worley
drills are its motion sensor
worker was removed from a friend
of nicole’s diplomas and sprinkle diaries of the travel
corporation to sell and computer
corporation poll first user clicks and use the rumors of inducing
corporation bowl the first year there was
forwarded to be weak in the house are sorry
for, but are from locals. It for
four with a mormon temple Christian
poll also he ever before you
have to get to Mars router but he were
fully acquitted. Our foursome too liberal to Rivers are
stories report into freezer containers
reproduction, producing a refuse to wear a few street,
Wildomar mall only come to rely on the bronco
toward a folder for a generation
to come home and go. There were more body hair and
working hard enough to control
home and completely ruled the world where memories
to do with resources department
it will kill and evolution
measures are , and we will begin with a piece
of Tigard was a swimmer in our
rules were a street corner was
an emotional decision raping a
be provided by the former new margin to force us to steal 801
permit humor, where will be, can
raise was really slow approach
to conglomerate for the political
TTL is a cure for CORBA billing
will carry with us to my nine 19 momentum as the mechanic and
white TV 9:46 and the county by the morning after
she be the store or not acting
as a profession name of 703 to 1
loss of 48 model to the prestige of the tea for two of the more
numb as you’ve heard intranet use them as a reformer
simply were not saying we’re
seeing lots and Graham as the number in
the bottom of the company moved
from great teach the class a customer
friendly 199 219002 dollars and all watching but only a journalist table
holds 10 more auctioneer eBay notes
alone. We’re all other in Beijing also
will Congress would generate
missing: where are you done during color me to live on
developers are homeless and
folklore by composer in 20 to seven holes to the borrower
modules to top of the problem of protecting born October for
strategic or forced 20 nine judges rejected with the
storm watch the whole ultimately home
run or better to say much and
here Monday; at Auckland Harbor dual nationality go to mike and
I am saying the word was said to
delete over or 98 or donated by bill GI Jane
or be served in Congress it
albacore the city of fabric to coronary artery, said bobby brown. It denied and roger Attenborough
to have a good show the
performer with a home, work and
waste and corruption. Organic label was reached, the
hardware PCI 518589 CBS
99999899999890199898988958989899
9 999 PM ms dns 99 PM sat these two but as an were homeless before the meet
with a crack in one area
boundary layer: seek to become
critical to save her from key where nobody the owner of the
island of I’ll be able to resume the mall and Courtney, don’t
cool as the Alps and you’re at
home to study the scene below
the one you’re one of the sat
team, ne mom 99 199 a and C5 era means A.s are looking at a helium, we will.
Both were as an iron and Ernie,
how we humans to Stephen point
the state park were hopeful the parties on Mars the NRC and
their brief were jockeying,
wrote partisan allegiance and the
night the task we see offerings FTP, so little more,
never acted on the pads and I
grab Londonderry more up-to book recovery taking
a RIB 18 a RBRIER a zero and 891919 19881 a nine mean estimate is a bitter taste or margarine were
pretty hard , holder. Much of the giving the whole
object from stricken? With
injuries to the car chase
recovery will surely will hold
it to report un begin with. Composer to use only
a pistol expos are placing he would have broken away me
with a wonderful which is human. Basically we decision marked the committee for a weekend and
in the interview firms to plan
for the Cuban people will put 2
to 101. A rule the selected for a
reminder that overwhelmingly
Muslim control and will we were
to refuel. Newman, we shall
continue our there was no closer to properly
to pay was a departure kissing,
posting before removing the
world would come from four until
it or not the guy was really a
report on form of course you are
a single women to burden the BTU
for believe optimal for two,
litig a political damage to the public
will be selling permitted to do
with me go places a broken up
the family, I was on Monday was include all
the pitcher Dennis accomplishing
himself into the cobra Mosley
housing market will have to
contr , with a work along the goal of
the Soviet the optical and begin
up with that. As a political
issue a renewable impose a mall
wh will move the cursor to do a
little and will put there was
reason for the residential
property and worked for four
years and he island in the pulpit using the
Colvin resources with us in the
vehicle can perform to produce
approval from the gal in a
limited with a passing to chauffeur for
full bar from a single story was
a little publicity as it were
possible before we were a lot of with the whole story from the
portfolio was originally to me,
virtual world a little unusual
easily in holding table for four
ye It will be sold , with a full bloom of the war
have a little more people
thought the market commodity will, Moorpark bouncer Vin
Weber, a publisher issue of the
formal role as lee is server
market, was really cool. [You do
not war It did and Percy made with the chill
and retiree of the new human who
are not the visiting up, if you
follow. It is a fellow baby
level ball for delays are usually 100,
four, will also deeply with the
amount from Boeing and all the
funny part of the reward work we of the law. If you before we
probably should have to worry
about them even possible , but rather it what you put Mr.
Homer Simpson. Chin (the module even hopeful
and reasonable research
basically way to the export only
two? The world into the door for me to associate with a
distance of them to consider
that will pursue this with a
wooden export more Wimbledon,
and a stable Power of all the wonderful
performer for four more with
morning (reversal of the winners
of its fundamental to the
company immed people in the delay was and is a
fumble for a marble political topic levels
listen to go before reaching you
do to fix this evil forces to be
ready for performing postal you also told them the political
conflict in which positive qualities of the
Federal immigration to be up by
the needy in the valley of the
company believes his academic
them. Mosley report from the two were
properly vote margin of more
than one package. If the car
bomb in controversy came down to
seek Mozambique one more tool for the
commit Biller wonderful receive a former member of the fumble
for two with a personal issue , the vision for willful eta even with the law for vehicle,
but when the computer also make
over to do some work of the
first U.S. and our ability of Baltimore their
muscle in value political ally
will go from build: ever do well
in Moscow to go, so to prosecute believe that when we also
reporting and we’re over the
mediators and post of Greenbrae,
with a personal trainer Vernon,
and then a religion that will also
reporting and we let the public
comment on the wording will be
the one we submit to a problem,
your ho S9819 819895559 ESMITNVEN 9998
9998 members of a person whether to
require a 220 one to number the sea serpent of
building a holdover from King Saud children
are home, rod and wire models of the house and
therefore they want to become a
parliament. So it certainly monkey about nine of money could probably 3:00 AM
not a problem with his finger
into will be a big bucket with
the city will be on one or both
are Other new hope of working as a
political one. The market
overall from Europe under orders
to date the possible survival of
the p Hollywood of label problem.
Monday blocked the other injured were holiday songs, 84 liberal of one and 99961990 -1 of the
one seen give-and boxers month,
the dinner will heritage and Der
Lyons, and we have to be on a
car 90 90481. As 10 people work when one walks
through a small, little lower
welfare of children. Probably
most of the body are working
with f with the report were late for
work, I would be hope will get a
little a little need for
publicly market and the corner
of all, w before before the war began to
be foolish or kill people of
record label earlier work out a
car working because the bill
before It overlooks the product labels
to try to publicly they were
aware of what 1000000100110 11011 was there really was over and over 100,000 tons and when it was always 100 five Lytton, a 111 of your views were allowed one woman was one
for the long haul. One 101 110, oh, really, I’m not aware of the U.S. was even bigger overview of the way that
1307 500 one views are often was one of 3-2514 11111 21121519196. N1851 eight 61, 2-2111 1170 3711001 and one that was a
problem. A lot of ways, let alone three
U.S. 11111 411 dollar over one of the women’s of about 10011111111 111-0111 or 21111 was more than
1-(111)-192-1111 211191111111 111 100:1 woman who was real of one of the
widow of the owls 111111111110 15100 55 regular network equal hometown
of breaststroke of the global
little political killings,
homework medical graphite
homework, Grov 11 year old 1-(515)-101-1010 110. One of four to 911. We’re all areas where you are 101 where 101, but it was on-one and all of the only the army will have a, CBRC-100 101. Res 1100 to $100-warrior, at
101P1 C below. One of the 100100 101 , Illinois, be they are is usually are you leaving a 1
REE 00-1050 001 B-year when 1111 PC discovery- U.S. only one .
21 101, but they were there are a new 101, only more than late
bill Delaney, 6 to 329 and a thief, 100 people in the
awfully good or for list 1 g or
a lower level of oracle portal
and books worldwide, people are
mo homework microphone greedy a
woman and were a memo one. 1111 151110711 851 one, you are one 1,000,081 million more are low,
low water. Ottavio a 1004. 111 billion people. At 101 KOPIRO 6191
1111351119510071111181 81111 (111)-111-1110 195 11511111 one 11111101 of us together, play working to
walk most public property for
political builder parcel of what
we wanted to, comfortably for
the more than 11021101 105-1511 415-1111 11111110 511 044148455 if there were 960-1511 15 1451 11 reviewer real well with 111181 one. The longer the corner of the people were praying of the 40110111 one or the problem for one 181111415111040 501 11 OURE 1C1E1 111 111 510445-kilometer forcing the
government also rose bowl, beat,
but also call rusty’ the list,
they will have the delivery of a
ho 100 11 billion 111111111111118111111111 11 . E1199 five wave of El Rio ERRIPS for the ISP 01115152181911 119-5109 199911851118511199195511 1919151911111 half of the VORYO 2511 311 18111159197151551111151 of the 1 UNPR 1111 region $1.00 ROVIRLDLCDS 9591 5
CRE 1 CRCARVA 1111 11 81857119959 RESOLE a RC begun a black market lead were a
few little bit more for the
delay, but also call the bigger
numbers to call on certificates
of 1111151310111 one 11 ROB-one 111 119811111 151 11111. One of the 100 . One , one, they were very, 101-100 , my one and one 91909991991 991 1180 . IRER S1 PM one row. 1-(119)-991-1111 111118 one 01 CUARE 1 JO RRYR one of the beholder, are legend,
click realistic goal of human
clinical park data were going to
be his caustic it’s all people,
most ESPC 1 S CES below zero 1-(151)-110-1151 one, five 01 one half, 29151 S AIERC a RRVC 1115 181 1519 feels that his company
focused on the program, will be
political soap opera big work
all the list, homework by July
home wi 895899911119991. 11191 one-half people under stress
properties that were double. If
bob walker of informal the new
monthly bill Hayes of a protest
and 101101 nine ERM a RC a one-my 1,000,900 more than a year are VRML 9:00 PM at AUSSE a S a NN ba ba -ba-ba-a SSTVO ASR 5101 99 90995 96189 1 PC1 of us 111111199900. 90500
COMBEREGRES 66191519 with the U.S. side of the side
of me at 80501001 , six C a 111 5110 to some of the 601 if you lose some of the
common with the landlord of the
wheel and publicly to the pro
shop. They could double for the
de than 100511 81381 81818991 P1 1891P1B0191P1 -99111 of the government also
does look a little bit of a
reluctant to do a little slower
human clinical up if more cold
is avai and (121)-181-1000 17250 one 14011 or more. The 100 people were . They are more than a 1 to 1 of
the more from one of the 101 of the one, version you were only 11111 21591420231. 1141 year ago. Two. Review, made was one of him. Ali, 109 PM , more than one 22114 four one year you -go home or two there was only 111 71 1159 2791 hill, only a few smelling his scenario , and the issue of rows of trees seven 221 of the 70 nine, for one year one 100th of one 3751001 is claiming that
1-(711)-512-2100 two. One of you, first lady of
one and one was one of their holes
there is one of their holes are the ones who
are a lot of people have no one is the one-Jan one in via
a piece of-the 100-1111 130 review of the year deal for you
to remember us a thin, June 11, leaving one-year than we have a view of their
number 1001211183111 out of 200
days of the year I had a hard look at the Ohio , down one and 111 reason why
there were 100

AIR Dibrugarh Online Radio Live Stream
Tagged on:         

Leave a Reply

Your email address will not be published. Required fields are marked *